KEGG   Pseudoxanthomonas suwonensis J1: WQ53_02775Help
Entry
WQ53_02775        CDS       T04241                                 

Definition
(GenBank) peptidase M20
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
psuw  Pseudoxanthomonas suwonensis J1
Brite
Enzymes [BR:psuw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     WQ53_02775
Peptidases [BR:psuw01002]
 Metallo Peptidases
  Family M2
   WQ53_02775
Exosome [BR:psuw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WQ53_02775
CD molecules [BR:psuw04090]
 Proteins
  WQ53_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
626880..628859
Genome map
AA seq 659 aa AA seqDB search
MKHRHLLLPLAIAAGVLSLSACKKEASPEAAPAAAQSGETADEFVARINAEYKAALPEIS
SAQWLSQTYINEDSQRIAAKANERALTQLNVWIEEARKFEGQPMSEDSQRTLALLKLMSA
MPAPKDPARLAELTTIAAKMEGAYGAGTYCTGEGAARKCRQLGELEDVLRSSRDYDAQID
AWQGWHSTAAPMRQDYARFVELVNEGAREQGYADAGAMWRSGYDMAPDAFAAETDRLWDQ
VRPLYEQLHCFARDRLQQTYGVEKGQVAGGLLPAHLTGNMWQQDWGNLWDILQPYPGVGS
LDITAALEKQYQQDLGAALQKRGAGADAKARFEAEREAQLHVARQMTERAQDFYVSLGMP
KLPDSYWAKTQFIKPLDRDVVCHASAWDLDMEGDVRTKMCIKPNEEDFTTIYHELGHIYY
DLAYNVQPPLFQNGANDGFHEAIGDTIVLAMTPKYLESIGLVEAQDQSQQALINAQMRMA
LAKVAFLPFGLMIDRWRWGVFDGSITPDRYNQAWWELKGKYQGVAPASARGEEFFDPGAK
YHVPGNTPYTRYFLSHVLQFQFYKSLCEAAGHTGPLYDCSFYGNPEAGRKFQAMLRQGAS
QPWQATMKELTGSEQIDGGAVLEYFAPLQEWLKKQNEGKQCGWQAAATPAAPPAPTGQG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaccgccacctgctgttgccgctcgccattgccgccggcgttctgtcgctgtct
gcctgcaagaaggaagcctcgcccgaagcggcgccggctgccgcgcagtccggcgagacc
gccgacgagttcgtcgcccggatcaatgccgagtacaaggcggccttgcccgagatcagt
tcggcgcagtggttgtcgcagacctacatcaacgaagacagccagcggatagcagccaag
gccaacgagcgcgcgctcacccagctcaatgtctggatcgaggaggcgcggaagttcgaa
ggccagccgatgtcggaagacagccagcgcaccctggcgctgctgaagctgatgagcgcg
atgccggcgcccaaggacccggccaggctggcagagctgaccaccatcgcggcgaagatg
gagggcgcctatggcgccggcacctactgcaccggcgagggggcggcgaggaagtgccgc
cagttgggcgaactggaggatgtgctgcgttccagccgcgactacgacgcccagatcgac
gcctggcagggctggcactccaccgccgcgccgatgcgccaggactacgcgcgcttcgtc
gagctggtcaacgaaggcgccagggaacagggctacgccgacgccggtgcgatgtggcgc
agcggctacgacatggcgcccgacgcgttcgccgccgaaaccgaccgcctttgggaccag
gtccgcccgctgtacgagcagctgcactgcttcgcccgcgaccgcctgcagcagacctac
ggcgtggagaagggccaggtcgcaggcggcctgctgccggcgcacctgaccggcaacatg
tggcagcaggactggggcaacctgtgggacatcctgcagccttacccgggcgtgggcagc
ctggacatcaccgcggcgctggagaagcagtaccagcaggacctgggcgcggcattgcag
aagcgcggcgcgggcgccgacgcgaaggcccgcttcgaggccgagcgtgaggcgcaactg
catgtcgccaggcagatgaccgagcgtgcgcaggacttctacgtgtcgctgggcatgccc
aagctgcctgacagctactgggccaagacccagttcatcaagccgctggaccgtgacgtg
gtctgccacgccagcgcctgggacctggacatggaaggcgacgtgcgcaccaagatgtgc
atcaagccgaacgaagaggacttcaccaccatctaccacgagctgggccacatctattac
gacctggcctataacgtgcagccgccgctgttccagaacggcgccaacgacggcttccac
gaggccatcggcgacaccatcgtgctggcgatgacccccaagtacctggagtcgatcggc
ctggtcgaagcccaggaccagagccagcaggcgctgatcaacgcgcagatgcgcatggcc
ctggccaaggtcgcgttcctgccgttcggcctgatgatcgaccgctggcgctggggcgtg
ttcgacggctcgatcacgccggaccgctacaaccaggcctggtgggaactgaagggcaag
taccagggcgtggccccggccagcgcgcgcggcgaggagttcttcgatccgggcgccaag
taccacgtgccgggcaacaccccgtacacgcgctacttcctctcgcacgtgctgcagttc
cagttctacaagtcgctgtgcgaggccgccggccacaccggcccgctgtacgactgcagc
ttctacggcaacccggaggcgggcaggaagttccaggcgatgctgcggcagggcgccagc
cagccctggcaggccacgatgaaggagctgaccggcagcgagcagatcgacggcggcgcg
gtgctggagtacttcgccccgctgcaggagtggctcaagaagcagaacgagggcaagcag
tgcgggtggcaggcggcggccacgcccgcggcaccgccggcgccgaccgggcagggctga

DBGET integrated database retrieval system