KEGG   Paenibacillus swuensis: SY83_07235Help
Entry
SY83_07235        CDS       T04884                                 

Definition
(GenBank) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pswu  Paenibacillus swuensis
Brite
Enzymes [BR:pswu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SY83_07235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu LPAM_2
Motif
Other DBs
NCBI-ProteinID: ANE46106
UniProt: A0A172TGP2
LinkDB All DBs
Position
1653476..1654036
Genome map
AA seq 186 aa AA seqDB search
MSRTQATALSVVCVVSIILLSACGLKSASVSSEIPAASPVEVKLIDTTGKPAGTAMLKQQ
ANGVLVHIQATGLTKGKHGFHFHEAGKCEAPTFKSAGEHFNPTQKEHGFNNPKGFHGGDL
PNLVADAKGQATAEIFVDYVTLAEGKPNSLLKEGGTSIIIHTGEDDYVTNPAGNSGDRAL
CGVISK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacacaagcaacagcattatcagtcgtatgcgtcgtaagcatcatcttgtta
tccgcttgcggattgaaatcagcttccgtcagttccgaaattcccgcggcctcccccgtt
gaagtcaagctgatcgataccacgggcaaaccggcaggaacagctatgttaaagcaacag
gccaatggcgtcctggtccatatccaggcaacgggactaacgaaaggcaagcatggattt
cacttccacgaggcggggaaatgtgaagcgcctacttttaagagtgcgggcgaacatttc
aacccgacgcagaaagaacatggcttcaataatccgaagggcttccacggcggggatctt
ccgaatcttgtggcagatgccaaaggacaagcgacagccgaaatcttcgtggattatgta
acgcttgcggaaggcaaacccaacagcttgcttaaagaaggcggaacttcgatcatcatt
cataccggcgaagatgattatgtgacgaatcccgcaggcaattccggggatcgcgcatta
tgcggtgtcatctccaagtaa

DBGET integrated database retrieval system