KEGG   Paenibacillus swuensis: SY83_13285Help
Entry
SY83_13285        CDS       T04884                                 

Definition
(GenBank) hypothetical protein
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pswu  Paenibacillus swuensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pswu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SY83_13285
Enzymes [BR:pswu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SY83_13285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3004589..3006604
Genome map
AA seq 671 aa AA seqDB search
MYFGVDYYPEHWPKGRWAVDAAMMREAHINIVRLAEFAWAKMEPEEGRFDFTWLDEAIRI
FQAEGIQVILGTPTAAAPKWLMDLYPDMYPVDVYGMTKGFGTRRHYCPNHIIYRQYSRII
VQKMVEHYADQEQVIAWQIDNEFGGACYCNHCLKAFRLWLRNKYGDIQTLNAEWGTIFWS
QTYRHWDEIIVPAYSSSDGFSQNANAEQWMSTPYNHNPSLLLDYQRFFTDATVDYQQLQI
DVLRQYTKLPITHNLMGHYSELDYYKLGEPLDVISWDNYPNNMWGKSSWTDISMAHDLMR
GVKEKNFWMMEQQSGPCGWQMMGDTPEPGQIRLWTYQAIAHGAEAMVYFRWRACTVGIEQ
YWHGILDHDGIGRRRLREVTQVGEELKRDAAWFVDSENRSDIALIKSYDNFWSHRGQPHN
SKFNYNALLSQYYGALATQHYGVDVTKAETNFAKYKLVLMPAFNLVTEEIADKCERYVAD
GGALVITFRSGTKLWNNQMSTLTVPGLFKDMAGVELEEFDSVNFGRTVAVDGSFGNSNAS
MWCDVLKLNGAEVLATYGSHYYEGKPAVTVNRYGKGTVYYVGCDLDTAGMTHLLKAIASE
QGVRPVLSQPTEGLEAVRKRKDEQDYIMLLNHNAHALEVTLQGTYTNLHDGAVMEGRTEI
AGYGVRILIQE
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgtattttggtgtggattattacccggaacattggcccaaggggcgttgggcggtcgat
gcagctatgatgagggaggcccatatcaacattgtgcggctggctgaattcgcatgggcg
aagatggagccggaggaaggccgattcgatttcacatggctggatgaagcgattcgtatt
ttccaagcggaaggcattcaggtcatattgggtacaccgaccgcggctgcgcccaagtgg
ctgatggatctctatcctgacatgtatcctgtggatgtatacggaatgaccaaagggttt
ggcacaagaaggcattattgtccgaatcatatcatttatcgtcaatattcccggataatc
gttcagaagatggttgaacattacgcggatcaagaacaagtcattgcatggcaaatcgat
aatgaatttggcggtgcttgttactgcaatcattgtctgaaagcgtttcgattgtggctt
aggaacaagtacggcgatattcagacgttaaatgcggaatggggcacgatcttctggagc
cagacttaccggcactgggatgaaattattgtgcccgcctattcttcaagtgacggattt
agtcagaatgcgaacgccgagcaatggatgagcacgccttacaatcataacccaagcctg
ctgctggattaccagcggttctttaccgatgcaacggttgactatcaacagctccagatt
gatgtgcttcgccaatatacaaaattgccgattacgcacaatctgatgggacattatagc
gaactggattattataagctgggcgaacctctggatgtgatttcttgggataactatcct
aacaatatgtggggcaaaagctcgtggacggatatctcgatggctcatgatttgatgcga
ggcgttaaagagaagaatttctggatgatggagcagcagagcggtccctgcggatggcag
atgatgggcgatacaccggaacccgggcaaattcgtttgtggacatatcaagcgattgcc
cacggtgccgaggcgatggtttacttccgctggagagcttgtacagtaggcattgaacaa
tattggcacggcattctggaccatgacggcatcggcagaagaaggttgcgggaagtgacg
caggtcggcgaggaattgaagcgggatgcggcctggttcgtggattctgagaatcgcagc
gatatcgcgctaatcaagagctatgataatttctggagtcatcgcggtcagcctcacaat
tccaagttcaattataacgcacttctaagccaatattacggcgcactggctacccagcat
tatggcgtggatgttacaaaagcggagactaatttcgcgaaatataaactggttctcatg
cctgctttcaatctggtaaccgaggagatagcagacaaatgcgagcgttatgtcgctgac
ggcggggctcttgttatcacattccgttcgggaacgaagctatggaataaccaaatgagc
actctaacggtgcccgggttattcaaggacatggcaggcgtggaactcgaggaatttgat
tccgttaacttcgggagaacggtagcggtggacggcagtttcggcaatagtaacgcctcc
atgtggtgcgatgtgctgaagctaaacggcgcggaagtacttgcaacttatggcagccac
tattacgagggaaaacccgcagtgacggtcaatcgttacggcaagggtacggtttattat
gtcggctgcgatctggacacggccggtatgacccatttgttgaaagccattgcatccgag
caaggtgttcggccggttctaagtcaacccaccgaaggtctggaagcggtccgcaaacgt
aaagacgaacaggattatatcatgctcctgaaccataatgcacatgccttagaggtgacc
ctgcaaggcacttatacaaatttgcatgacggcgcagttatggagggcagaacggagatt
gccggttatggcgtgcgaattttaatccaagaatga

DBGET integrated database retrieval system