KEGG   Psychrobacter sp. AntiMn-1: AOT82_2344Help
Entry
AOT82_2344        CDS       T04964                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psya00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AOT82_2344
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOT82_2344
   00620 Pyruvate metabolism
    AOT82_2344
   00630 Glyoxylate and dicarboxylate metabolism
    AOT82_2344
  Energy metabolism
   00680 Methane metabolism
    AOT82_2344
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AOT82_2344
Enzymes [BR:psya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AOT82_2344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2604288..2605277
Genome map
AA seq 329 aa AA seqDB search
MSMKQPLRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEITPALDALKGVVMELE
DCAFPLLAGIVQTDDANVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKALNE
VASRDVKVLVVGNPANTNALIAQRNAPDLDPRNFTAMTRLDHNRAMAQLAEKTDSTVNDI
KNMTIWGNHSSTQYPDLTAATVNGKPALELVDRDWYENTYIPEVQQRGAAIIKARGASSA
ASAANAAIAHMRTWALGTDENDWVSMGVYSNGEYGIAEGLIYSFPCTCKNGDWSIVDGVD
VSSEFSKEKMAATEQELSEERDAVAHLLP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatgaaacagcctttacgtgttgccgtcactggtgccgctggtaatatcagctac
gcgatgctatttcgtattgcatctggcgagatgctaggtaaagatcagccagttattttg
caattgcttgaaatcacaccagcgcttgatgccctaaagggtgtggtcatggaactagaa
gactgcgcattcccattgcttgctggtattgtccaaactgatgatgcaaatgtggcattc
aaagatgctgactacgcgttactcgtcggtgcccgtccacgtggtccaggtatggagcgt
aaggacttactagaagccaacgctgcgattttctcagcacaaggcaaagcattaaacgaa
gtcgctagccgtgatgtaaaagtattggtcgtcggtaaccctgccaacaccaacgcgcta
atcgctcagcgtaacgcaccagacctagatccacgtaactttactgccatgactcgccta
gatcataaccgtgcgatggcacagctagccgaaaaaactgacagcactgttaatgacatc
aaaaacatgaccatctggggcaaccactcatcgacccagtatccagacctaacggctgcg
actgtcaatggcaaaccagcgctagagttggttgatcgtgattggtacgaaaacacgtat
atcccagaagtacagcagcgcggcgcggccatcattaaagctcgcggcgcctcatctgca
gcttctgctgccaacgctgctatcgcccatatgcgcacgtgggcactcggtactgacgag
aacgattgggtctctatgggtgtttactcaaatggggaatatggtatcgctgaaggcctt
atctactcattcccatgcacatgcaaaaacggcgactggtctatcgtagacggcgttgat
gtgtcatcagaattctcaaaagagaaaatggccgccactgagcaagagctgagcgaagag
cgtgatgcagtagcacacctactaccataa

DBGET integrated database retrieval system