KEGG   Psychrobacter sp. AntiMn-1: AOT82_603Help
Entry
AOT82_603         CDS       T04964                                 

Definition
(GenBank) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psya  Psychrobacter sp. AntiMn-1
Pathway
psya00010  Glycolysis / Gluconeogenesis
psya00053  Ascorbate and aldarate metabolism
psya00071  Fatty acid degradation
psya00280  Valine, leucine and isoleucine degradation
psya00310  Lysine degradation
psya00330  Arginine and proline metabolism
psya00340  Histidine metabolism
psya00380  Tryptophan metabolism
psya00410  beta-Alanine metabolism
psya00561  Glycerolipid metabolism
psya00620  Pyruvate metabolism
psya00625  Chloroalkane and chloroalkene degradation
psya00903  Limonene and pinene degradation
psya01100  Metabolic pathways
psya01110  Biosynthesis of secondary metabolites
psya01120  Microbial metabolism in diverse environments
psya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOT82_603
   00053 Ascorbate and aldarate metabolism
    AOT82_603
   00620 Pyruvate metabolism
    AOT82_603
  Lipid metabolism
   00071 Fatty acid degradation
    AOT82_603
   00561 Glycerolipid metabolism
    AOT82_603
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT82_603
   00310 Lysine degradation
    AOT82_603
   00330 Arginine and proline metabolism
    AOT82_603
   00340 Histidine metabolism
    AOT82_603
   00380 Tryptophan metabolism
    AOT82_603
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOT82_603
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AOT82_603
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AOT82_603
Enzymes [BR:psya01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AOT82_603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 DUF3456
Motif
Other DBs
NCBI-ProteinID: AOY42982
UniProt: A0A1D9CWQ7
LinkDB All DBs
Position
complement(694177..695661)
Genome map
AA seq 494 aa AA seqDB search
MSSNDNNSNAYSDFHLQFIGGEWQKGKDDSINTDTNPYNGDTIVEIQQATKDQLDEAYDA
ADQAQAKWAKTTPAERAAVMYKVVSILDQRQDEIVDWLIKESGSTRIKAMVEFSSARAIT
LEAASFPNRVHGEIRPSNTPGKENFIYREPIGVVAVISPWNFPLHLTQRSIAPALALGNA
VVLKPASDTPVTGGLLLAKVFEEAGLPKGLLNVVVGSGSEIGDAIVEHKAPSLVSFTGST
SVGQHIGELANGGEYIKQVALELGGNSPFVVLKDADIEQAVKAAAFGKFLHQGQICIAIN
RVVVEDEIYDDFVERFLAHVKTLNVGDPNKQDTAVGPIINEKQLKSLKDKIAKAQDEGAK
MILSGEIEGQVVPPHIFTEVTREMDLSCNEVFGPLVGIIRAKDEDDALSIANDSMYGLSS
AVFTADMQKGLRFARGIRAGMTHINDISVNDESNTPFGGEKNSGIGRFNGEWVLEEFTRT
HWISMQNEPRQYPF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcaatgataataacagtaatgcctatagcgattttcatttgcaattcattggc
ggtgaatggcaaaaaggtaaagatgatagcattaatactgataccaatccctacaatggc
gatacgattgtagaaattcagcaagcgactaaagaccagcttgatgaagcatacgatgct
gccgaccaagcgcaagccaaatgggcaaaaacgacgccagctgagcgtgcagctgttatg
tataaggtagtcagtatcctagatcagcgccaagatgaaatcgttgactggttgatcaaa
gagtcgggcagtacacgcattaaagccatggttgaatttagctcggcacgtgccatcacg
cttgaagcagcgtcttttcctaaccgcgtacacggtgagattcgcccctctaacactcct
ggcaaagaaaacttcatttaccgtgagcccatcggagtggtagcagtcattagcccatgg
aactttccgctgcatttaacccagcgttctatcgcaccagcattagcccttggtaatgcg
gttgtattaaagccagcaagcgacacaccagtgacaggtggcttactactagcaaaagtg
tttgaagaagcgggtctgccaaaaggtctattaaacgtcgtggtcggctccggtagtgag
ataggcgatgccatcgtcgagcacaaagcgccaagcttagtatcattcacaggctcaacc
tcagtaggccagcacatcggtgagctagcaaatggcggtgagtatatcaaacaagtcgcg
cttgagcttggcggcaacagtccatttgtggtactcaaggatgctgacattgagcaagca
gtcaaagcagctgccttcggtaaattcttgcatcaaggccaaatctgtatcgcgatcaat
agggttgtcgtggaagacgagatatatgatgacttcgtagagcgtttcttggcacatgtc
aaaacattgaatgtcggtgatcctaataagcaagatacggctgttggccctatcatcaac
gaaaaacaactcaaatcgctcaaagataaaatcgccaaagcgcaggacgaaggcgcgaaa
atgatactcagtggtgagattgaaggccaagtcgtaccgccgcatatctttactgaagtc
actcgcgagatggatctatcctgtaatgaagtatttggcccattggttggtatcattcgt
gctaaagacgaagacgatgcattatcaatcgccaatgactctatgtatggcctatctagt
gcggtattcactgctgatatgcaaaaaggtttgcgttttgctcgtggtatcagagcaggt
atgacccatatcaatgacatctcggtcaatgacgaaagcaatacgccatttggtggtgaa
aaaaactcaggtatcggtcgctttaacggtgaatgggtactagaagagttcaccagaaca
cattggatttcaatgcaaaacgagccacgtcagtatccgttctaa

DBGET integrated database retrieval system