KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_1207Help
Entry
DABAL43B_1207     CDS       T04748                                 

Gene name
pchA
Definition
(GenBank) aldehyde dehydrogenase (NAD+)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
psyc00010  Glycolysis / Gluconeogenesis
psyc00053  Ascorbate and aldarate metabolism
psyc00071  Fatty acid degradation
psyc00280  Valine, leucine and isoleucine degradation
psyc00310  Lysine degradation
psyc00330  Arginine and proline metabolism
psyc00340  Histidine metabolism
psyc00380  Tryptophan metabolism
psyc00410  beta-Alanine metabolism
psyc00561  Glycerolipid metabolism
psyc00620  Pyruvate metabolism
psyc00625  Chloroalkane and chloroalkene degradation
psyc00903  Limonene and pinene degradation
psyc01100  Metabolic pathways
psyc01110  Biosynthesis of secondary metabolites
psyc01120  Microbial metabolism in diverse environments
psyc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psyc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DABAL43B_1207 (pchA)
   00053 Ascorbate and aldarate metabolism
    DABAL43B_1207 (pchA)
   00620 Pyruvate metabolism
    DABAL43B_1207 (pchA)
  Lipid metabolism
   00071 Fatty acid degradation
    DABAL43B_1207 (pchA)
   00561 Glycerolipid metabolism
    DABAL43B_1207 (pchA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DABAL43B_1207 (pchA)
   00310 Lysine degradation
    DABAL43B_1207 (pchA)
   00330 Arginine and proline metabolism
    DABAL43B_1207 (pchA)
   00340 Histidine metabolism
    DABAL43B_1207 (pchA)
   00380 Tryptophan metabolism
    DABAL43B_1207 (pchA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DABAL43B_1207 (pchA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DABAL43B_1207 (pchA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DABAL43B_1207 (pchA)
Enzymes [BR:psyc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DABAL43B_1207 (pchA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: SLJ84403
UniProt: A0A1U6GLK2
LinkDB All DBs
Position
I:1391608..1393092
Genome map
AA seq 494 aa AA seqDB search
MTPNNTHSNPYSDFDLQYIAGKWQKGRDDSVNTDTNPYNGDTLVEIQQATKEQLDEAYQA
ATKAQAEWAQQTPAERASVLYKVVAIFDQRQDEIVDWLVKESGSTRIKAMVEFGSARAIT
LEAASFPNRVHGEIRPSNTPGKENFIYREPMGVIAVISPWNFPLHLTQRSIAPALALGNA
VVLKPASDTPITGGLLLAKIFEEAGLPKGLLNVVVGAGSEIGDAIVTHDIPSLVSFTGST
SVGKHIGELANGGDYIKQVALELGGNSPFVVLKDADIEQAVKAAAFGKFLHQGQICIAIN
RIIVEDEIYDDFVARFLAHVKTLSVGDPSKEDTAVGPIINDKQVKSLKEKIAKAQKEGAK
MILSGEIKGQVVPPHIFTEVTREMELSCDEVFGPLVGIIRAKDEDDALSIANDSMYGLSS
AVFTKDMEKGLRFARGIKAGMTHINDISANDDSNAPFGGEKNSGIGRFNGEWILEEFTTL
HWISVQHTPRDYPF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactcccaataatactcattcaaacccttatagtgatttcgatttgcaatatatcgct
ggcaagtggcaaaaaggtagagacgatagtgtcaataccgataccaatccttataacggt
gatactttggtagagattcagcaagcaacgaaagagcagcttgatgaagcctatcaagca
gcaactaaagcacaagctgagtgggcgcagcaaacgccagccgagcgtgctagtgtactt
tataaagtcgtcgctatttttgatcagcgtcaagatgaaattgttgactggttagtgaaa
gagtcgggcagtacccgtatcaaagcgatggtagagttcggtagtgcacgtgcgattacc
cttgaagcagccagttttccgaatcgtgtgcatggtgagattcgtccttctaacacgcct
ggtaaagaaaactttatttatcgtgaaccgatgggtgtgattgcggttatcagtccatgg
aactttccactccatttaactcagcgttctatcgcgcctgctttagcattgggtaatgcc
gttgtgcttaagcccgctagtgatacgccaataactggtggtttgttattggcaaaaata
tttgaagaagctggtctgccaaaaggcttgcttaatgtggttgttggtgctggtagtgag
ataggggacgccattgtcacccacgatataccaagtttggtatcgtttacggggtcgact
tcagtaggtaaacatatcggtgagttggcgaatggcggtgactacatcaagcaagtggca
ctggagctcggcggtaacagcccgtttgtggtactaaaagatgccgatattgaacaagca
gtgaaagcggcggcctttggtaaattcctgcaccaaggtcagatttgtatcgctatcaac
cgtattattgttgaagatgaaatctatgatgattttgtagcgcgtttccttgctcatgtt
aagaccttaagcgttggcgatcctagcaaagaagatactgccgttggtcctattatcaat
gataagcaagtgaagtcattgaaagaaaaaatcgctaaagcgcagaaagaaggcgcgaag
atgatattaagcggtgagataaaaggtcaagtagtgccgccacatatctttactgaagtg
acccgtgagatggaattatcatgtgatgaagtatttggtcctttagtgggtatcatccgt
gctaaagatgaagacgatgcgttatcgattgccaatgattcaatgtatggcttatcgagt
gcggtatttaccaaagatatggaaaaaggcctacgctttgctcgcggtattaaagcgggc
atgactcatatcaatgatatttcagccaatgatgacagtaatgcgccatttggtggtgag
aaaaactctgggatcggacgttttaatggcgagtggatactagaagagtttactactttg
cattggatttcagtccagcatacaccgcgtgactatccgttttaa

DBGET integrated database retrieval system