KEGG   Psychrobacter sp. DAB_AL43B: DABAL43B_2341Help
Entry
DABAL43B_2341     CDS       T04748                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
psyc  Psychrobacter sp. DAB_AL43B
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psyc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DABAL43B_2341 (mdh)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DABAL43B_2341 (mdh)
   00620 Pyruvate metabolism
    DABAL43B_2341 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    DABAL43B_2341 (mdh)
  Energy metabolism
   00680 Methane metabolism
    DABAL43B_2341 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DABAL43B_2341 (mdh)
Enzymes [BR:psyc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     DABAL43B_2341 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(2745198..2746181)
Genome map
AA seq 327 aa AA seqDB search
MKQPVRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEIAPALDALKGVVMELEDC
AFPLLAGIVQTDDATVAFKDIDYALLVGSRPRGPGMERKDLLEANAAIFSAQGKALNDVA
SRDVKVLVVGNPANTNAVIAQRNAPDLDPRNFTAMTRLDHNRAMAQLAGKTDSTINDVKK
MIIWGNHSSTQYPDLTACTVNGKPALDLVDREWYEATYIPEVQQRGAAIIKARGASSAAS
AANAAIAHVRTWVMGTDDNDWVSMGVYSNGEYGISEGLIYSFPCTCKDGDWSIVADVDVS
SAFSKEKMAATEQELNEERDAVAHLLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacctgtacgtgttgccgtaactggtgctgctggtaatatcagctatgctatg
ttatttcgtattgcatctggtgaaatgctaggtaaagatcagccagtaatcttgcaatta
cttgaaatcgctccagcactagacgccttaaagggtgtggtcatggaattagaagactgt
gcatttcctttgttggcaggtatcgtacaaactgatgatgccactgttgcgtttaaagat
atcgactatgctttactagtaggctcacgtcctcgtggcccaggtatggaacgtaaagac
ttgctagaagccaacgctgcgattttctcagcgcaaggtaaagcattgaatgacgttgct
agccgtgatgttaaagtattggtagtaggtaaccctgctaataccaacgctgttattgct
cagcgtaatgcaccagatttagacccacgtaactttactgcgatgactcgtttggatcat
aaccgcgcaatggcacagttagcaggtaaaactgacagcaccattaatgacgtgaaaaaa
atgatcatttggggcaaccattcatcaactcagtaccctgatctaacggcttgcaccgta
aacggtaagcctgcattagatttagtagatcgcgaatggtatgaagcgacttatatccca
gaagtacaacaacgcggtgcggcaatcattaaagctcgtggtgcctcttctgcagcctct
gctgcaaacgctgctattgcacacgtacgtacgtgggtaatgggtactgatgataacgat
tgggtctctatgggtgtctactctaatggcgagtatggtatctctgaaggcttgatttac
tcattcccatgtacttgtaaagatggcgactggtctatcgttgctgacgttgatgtgtct
tcagctttctcaaaagagaaaatggcagctactgagcaagagcttaatgaagagcgtgac
gcagtagcacacttactaccataa

DBGET integrated database retrieval system