KEGG   Psychrobacter sp. P11G5: AK825_06865Help
Entry
AK825_06865       CDS       T04411                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psyg  Psychrobacter sp. P11G5
Pathway
psyg00620  Pyruvate metabolism
psyg00680  Methane metabolism
psyg01100  Metabolic pathways
psyg01120  Microbial metabolism in diverse environments
psyg01200  Carbon metabolism
Module
psyg_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psyg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AK825_06865
  Energy metabolism
   00680 Methane metabolism
    AK825_06865
Enzymes [BR:psyg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AK825_06865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMN67467
UniProt: A0A127GYT8
LinkDB All DBs
Position
1645328..1648108
Genome map
AA seq 926 aa AA seqDB search
MMIDNNVLRERMSLLGSFLGAAISRQSGEQTVHTIETLRKGFIQQRREPNEAQKQELIDF
IASLDNQTLKNVIRGFSIYFFLANLSEENYLREQRHTLRVQSEQSWEGSFRRTLLECRER
NIEPAQMQELIDQLKFIPVFTAHPTEARRRTTMNILQSLFTHSDALNNLNEDSFAYEQAK
EQTAQTIDLLWSSDEVRTRKPLVYDEINNGLHYFNASLFNAIPKVYRNIKRAIIDIYPEL
ADYPLPAFMSFGSWIGGDRDGNPFVTFETTELAVLMHADTVLRHYQVLLKKLRRQLIHSD
TIVTVSAEVYAKIKSYDELDRRVFDYNLDDYGNEPYRRLLSLILTKVNATNRLIQSKGSD
SDAKKDAYADPEELLEDLRIIRQSVNGHDTAHAEGLLLDMIRLVKTCGFHLAALDIRQES
SYHSEVIADIFASASNLPDYQMLGESERQEWLTRLLEKPGTPLIYTDNLTDKTREQLALM
NSVATLRKLVGQETFGSYVISMTNNASQLLEVLLLMRFAGLCRVDDAGQLSADLPVAPLF
ETIEDLKNIDKILPAVLDNPLYRGLLQHSDNTQEIMLGYSDSSKDGGIITSAWQLYSAQQ
TINRIAEEYGIKTRLFHGRGGSVSRGGGSTHNAIAAQPAGTLHGQIKVTEQGEVLYAKYA
NTDTAVFELTMGITGTLKACSTRFVVQPAELPDYEALFARLADAGEQRYRELTDNTEGFY
QFYSQVTPVQEISLLNIGSRPAHRKKGLPSKTTLRAIPWVFGWSLARFTLPAWYGVGSAL
HSVKEDEELMREMNKHWPFFSVFISNIEMAFTKSEMNIAHAYSQLCEDEALREQIMKAVI
DEHDLTYSGLNSLLNQTSLLSNQQNLAASLQWRNAYLDPINYIQIELLKRARQKDVTGVV
DHDELDVEDPLIRSINALAAGLRNTG
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgatgatagataacaacgtattacgtgaacgcatgagcttattgggttcattcttaggg
gctgcgatttctcgccagtctggtgaacagacagtgcataccattgaaacactgcgtaaa
ggttttatccaacaacgccgcgagcctaatgaagcacagaagcaggagcttattgacttc
attgcctctttagataatcaaaccttaaaaaacgtcatacgtggcttttctatctacttt
ttcttagcaaatttaagtgaagaaaattacttacgtgagcaacgtcataccttgcgtgtc
caatctgaacaaagctgggaggggtcgtttcgtcgtaccctgcttgagtgtcgtgaacgc
aatattgaacctgctcagatgcaagagctgattgatcaactcaaatttattcctgtattt
accgcacaccctactgaagctcgccgccgtacgacgatgaatatcttgcaaagtctattt
actcatagcgatgctttaaataatcttaatgaagacagtttcgcctacgagcaagcgaaa
gaacaaacggcgcaaacgattgatttgttatggtcatctgatgaagtacgtacacgtaag
cctttggtttatgacgagataaataatggactgcattattttaacgccagtttatttaat
gccattccaaaggtttatcgtaatattaaaagagccattatcgatatctatccagagcta
gcagactacccattaccagcatttatgagctttggctcttggatcggtggtgacagagat
ggcaatccattcgtgacttttgagaccacagagcttgccgtactaatgcatgctgatacc
gtgttgcgtcactatcaagtactactcaaaaaactgcgccgccagctcattcatagtgat
acgattgtgacggtctcagctgaggtctatgccaagatcaaaagttacgatgagctcgac
agacgagtctttgattataatctagatgattatggcaatgagccttatcgtagattactc
tccttaattcttactaaagttaacgctactaatcgccttattcaaagtaagggcagtgat
agtgacgctaaaaaagatgcctacgccgacccagaagagctgttagaagatttacgcatc
attcgtcagagtgtgaatggccatgacactgcccatgcagaagggttattactcgatatg
attcgtctggtaaaaacttgcggctttcatttagctgcgctcgatattcgtcaagagtcg
tcttatcatagtgaggtgattgccgatatttttgccagtgcctctaatttgccggattat
caaatgctgggtgaaagtgagcgccaagaatggctcactcgtttgcttgaaaagcctggt
acaccgctcatctataccgataacttgactgataaaacacgtgaacaattggcattgatg
aactctgtggcgacattacgtaagctggttgggcaagagacctttggcagttatgttatt
tcgatgaccaacaacgccagtcaattattagaagtattgctattaatgcggtttgcaggc
ttgtgcagggttgatgatgcaggtcaactatctgctgacttaccagttgcgccgttgttt
gagacgatcgaagaccttaaaaatattgacaagatattacctgccgtgttggataatcca
ctctatcgaggactgctccaacactcagataacacccaagaaatcatgctaggctattca
gattcatcaaaagatggcggcatcattacctctgcatggcagctttatagtgcgcagcaa
accatcaaccgtatcgctgaggaatacggtatcaaaacgcgcttgttccatgggcgtggt
gggtcagtgagtcgtggtggcggatcaacacataacgcgatcgcagcgcaaccagcaggt
acactacatggtcagattaaagtaactgaacaaggcgaagtactctatgccaaatacgcc
aataccgataccgctgtattcgagctgaccatgggtattacgggtaccctgaaagcctgc
tctaccagattcgttgtgcagcccgctgagctgccagattatgaagcgctctttgcacgt
ttggcagatgcaggtgagcagcgttatcgtgaactgactgataatactgaagggttctat
cagttctactcacaggtgacccctgtgcaagaaatctctttattaaatattggctcacgt
ccagcgcatcgcaaaaaaggcttgccaagcaaaacgactttacgggccattccttgggta
tttggttggtcattggcgcgttttaccttacctgcttggtatggcgttggcagtgctcta
cacagcgtcaaagaagacgaagaattaatgagggagatgaataagcattggccatttttt
agcgtatttatcagcaatatcgagatggcttttaccaagtctgagatgaatatcgctcat
gcctatagtcagttatgtgaagatgaggctttgcgtgaacagattatgaaagcggtcatc
gatgagcacgatttgacctattcaggcctaaattctttgcttaatcaaacgtctttgtta
tctaatcagcaaaaccttgccgcctcactacagtggcgaaacgcttatttagatccgatt
aactatatacaaatcgagctgttaaaacgtgccagacaaaaagacgttacaggcgtcgtc
gatcatgatgagcttgacgttgaagatccattaatccgtagtatcaatgccttggccgca
ggtctacgcaacacgggttaa

DBGET integrated database retrieval system