KEGG   Pseudomonas syringae CC1557: N018_09040Help
Entry
N018_09040        CDS       T03014                                 

Definition
(GenBank) peptide synthase
Organism
psyr  Pseudomonas syringae CC1557
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1880187..1893200
Genome map
AA seq 4337 aa AA seqDB search
MMDAFELPDTLAQALQRRASQTPDRLALRFLSDEESQGLVLTYRDLDLRARTIAAALQGQ
TVPGDRAILLFHSGPDYVAAFFGCLYAGVIAVPAYPPESNRRHHQERLLSIIADAEPRLV
LTGSDVQPALLQMDELAAADAPPLLCVDTLDSASAQGWQGPHLQADDIAFLQYTSGSTAL
PKGVQVSHGNLVANELLIRHGFGIDVNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCIL
MAPAYFLTRPLRWLEAISEYGGTISGGPDFAYQLCSARVSDSALERLDLSRWRVAYSGSE
PIREDSLNAFAEKFASCGFTPDSFMASYGLAEATLYVAGGKRGKGIPSLRLNAQALSRNV
AELGDGQPVMSCGSGQPGHGVLIADPVTLQALDENSIGEVWASGPSIAHGYWRNPQATAN
TFVQHDGQIWLRTGDLGFQRHGELYITGRLKDMLIVRGHNLYPQDIEKVIEREIDVVRKG
RVAAFAVNQDGSEGIGIAAEISRSVQKVFPPEALIKVIRQTVAEAFQEAPSVVVLLNPGA
LPKTSSGKLQRSACRTRLADGSLDSYAVFPAADTALQNSARSAGSDLQAQIASVWCEQLQ
CEQVSADDHFFLLGGNSIVATQVVARLRETLGIDLNLRLLFEAPTLSAFAARIEALQITA
EQGDNPTQNAIVRLPGNEHLPQSLAQNRLWFLWQLDPASSAYNIPGGLHLRGELHVEALR
SSFQRLIERHESLRTRFYEQDGVALQRIDAPGEFQLHRIDISDLSGDERQARALAIREEQ
ARLPFDLQNGPLLRVTLLQLDEEEHQLLVTLHHIIADGWSLNVLIDEFSRLYASAVQGQS
LELAPLPLRYADYGQWQREWLARGEAERQLDYWKQQLGDEQPTLMLNTDHPRSLRRQHSA
SRYSVRLSAELSAAVRNTAQAWQSTPFMLLLAGFQTLLHRYSGQTDIRIGVPGANRPRHE
TQGLIGFFINTLVLRAQLDPRLPFSTLLAQTRQAALDAQAHQDVPFEQLVEAFPHAREHG
LFQVMFNHQQRDLGALRRLPGLLAEELPWHSREAKFDLQLHSEEDRNGRLNLSFDYADEL
FERDTIVRLAKHYVQLLTQVSQQAQVALGDVQLLNAEELAEQAQWSAAPCAPAQVWLPEL
LERQVLQTPERIALVWEGGSLDFADLHAQANRLAHYLRDKGVGPDIKVAIAAERSPQLLI
GLLAILKAGGAYVPLDPDYPTDRLAYMLQDSGVELLLTQSHLLGDLPSAEGVCTLAMDTL
HLDNWPISAPGLHLHGDHLAYVIYTSGSTGQPKGVGNTHAALVERLQWMQATYALDESDV
LMQKAPISFDVSVWECFWPLITGSRLLLAGPGEHRDPHRIAQLVNEYGVTTLHFVPPLLQ
LFIDEPLTQHCSSLRRLFSGGEALPSELRNRVLEQLPNVQLHNRYGPTETAINVTHWQCR
LADGLRSPIGRPLGNVLCRVLDSEFNPLPRGVAGELCIGGIGLARGYLNRPGLTAERFIA
DPLGQAGERLYRTGDLVRWTSDGALEYLGRLDQQVKLRGFRVEPQEIEARLLAQQGVGHA
AVLVRETAAGPQLIGYYTAEAGQDVQAERLRSALALELPDYMVPAQLVRLDSMPLNPSGK
LDRRALPEPQWQTREHVEPHTNLQKQIATIWRQVLGVPRVGLRDDFFELGGHSLLATQII
SRVRQACDIDLPLRALFEASELGAFVEQVQTIQQSGARSSLQPIARVDRSQPVPLSYSQQ
RMWFLWQMEPDSPAYNVGGMARLNGVFDIQCFEAALQALIMRHETLRTTFPSVNGVACQK
VSEQTGLSVQWQDYSALPVDVRQQRLQALADSEAHQPFDLEAGPLLRACLVRAAELEHYF
VLTLHHIVTEGWAMDIFARELGLLYEAFLEGKPSPLEPLAVQYLDYSVWQRQWMEAGERQ
RQLDYWTAQLGNEHPLLELPGDRPRPPVQSHQGELYRFDLSPELAAKVRAFNARNGLTLF
MTMTATLAVLLYRYSGQNDLRIGAPVANRIRPESEGLIGAFLNTQVLRVQLDGQMSVAQL
FEQVRHTVIEGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQSRELAGMTV
DYLVNDARATKFDLNLEVTELDHRLGCCLTYSTDLFDEPRIAQMAGHWLNLLQALLVDPQ
QRLSELPLLQDAERQQLLDSLGVEAGGQRLDQCLHSLFAERARLRANAPALTFAGETLSY
AELDARTNQLAWMLRERGVGPQVRVGLALPRSLDMVVGLLAILKAGGAYVPLDPEYPLER
LHYMIEDSGVGLLLSDRALFAALGELPAGVARWCLEDDQPSLASFSSDELPFISLPQHQA
YLIYTSGSTGKPKGVVVSHGEIAMHCQSVIRRFDMRPDDCELHFYSINFDAATERLLVPL
LSGARVVLRAQGQWDAEEICTLIREQQVNILGFTPSYGSQLAQWLATQGQTLPVRMCITG
GEALTGEHLQRIRAVFQPELLFNAYGPTETVVMPLASLAPQQLEEGEASVPIGRVVGARV
AYILDADLALVPQGASGELYIGGAGLAQGYHQRPGMTAERFVADPFATNGGRLYRTGDLV
RLRADGLVEYLGRIDHQVKIRGFRIELGEIETRLLEHQAIREAIVLALDTPSGKQLAGYL
VSDVAGQGDEQQAQLRESLKAHLKAQLPDYMVPTHLILLASMPLTANGKLDRRALPAPDP
ELNRQHYIAPASELEQQLAAIWCAALNVEKVGLNDNFFELGGDSILSIQVVSRARQAGIH
FSPRDLFQHQTVQTLAAVATTRELIHAEQGLLEGVSALTPIQHWFFATPIPQRQHWNQSL
VLEPVSVLDPRVLEQALRAVLEQHDALRLSFTEHDGKWQAEHRAVTAETLLIQARVADLD
ECAALYADTQRSLDLQNGPLLRALLVDGPQGQQRLLMVIHHLVVDGVSWRVLLDDLQTAY
RQSSEAAPVRFAAKTSAFRDWAARLQAYAGNESLREELRVWKRQLGGPAAQLPCHNPQGG
QQNRHAQTVSVRLDAERTRQLLQQAPSAYRTQVNDLLLTALAQVVCRWSGQPSTLIQLEG
HGRENLFDDIDLTRTVGWFTSAYPLRLTPALAADAALGDSIKAIKEQLRKVPHKGLGYGV
LRYLADSASKAAMQALPVAPITFNYLGQFDQSFASDALFHPLEESAGAAHDPHAPLPNEL
SIDSQVYGGELLLRWTFSAERYQPAAIEALAQDYLTQLQALIAHCLSDGSGGLTPSDFPL
ADLDQAQLDALPVPANHIEDVYPLTPMQEGMLLHTLLEPGTGLYYMQDRYRINSALDPQR
FAQAWQMVIARHEALRASFCWDIGESMLQVIHKPGSKPIDYLDWRDVPSDQQEPRLQALL
KSERETGFDLLKQPPFHLRLIRVDEARYWFMMSNHHILIDAWCRSLLMNDFFDIYTALGE
GRDAQLAPAPRYRDYIGWLQRRGLAQARDWWQHNLRGFERPTPITSDRPFLREHAGDSGG
MVVGDCYTRLDERDGAQLRELAQQHQLTVNTFAQAAWALTLRRMSGDRDVVFGVTVAGRP
VELPQMQRTVGLFINTIALRVGMPGDEQRCTVRDWLSQLLDSNMQLREYEYLPLVTIQEN
SELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDSGRTHTNYPLTAVCYPGDDLGLH
LSYDQRYFDESTVQNMLGEFKRLLLALIEGFHGDMADLALVSEQERTFLLDGCNQSDHAY
PLDKSYVELFEAQVAAHPQRIAVSCLDRQVSYAELNITSNRLGHALVEAGVRFDHPVALL
AERGPELLGMIIGSFKAGAGYLPLDPALPNSRLSGIIGQSHTPVLVCSAQCLEQGRALLD
ALPEVSRPLLLVWENVQQSESAQHNPGRYSAPDNLAYVIFTSGSTGLPKGVMVEQRGMLN
NQLSKVPYLSLSETDVIAQTASQSFDISVWQFLAAPLFGAQVAIVPNDIARDPQALLAHV
QAQRISVLESVPSLITGLLAEESATLDSLRWMLPTGEAMPPELASQWLQRYPQIGLVNAY
GPAECSDDVAFFRVDAESTRSTYLPIGSPTDNNRLYLLDDALDLVPLGAVGELCVAGAGV
GRGYVADPLRTVPVFIPNPFGSPGERLYRTGDLAKRRKDGVLEYVGRVDHQVKIRGYRIE
LGEIETRLLEHPALRESVVLDIDGPLGKVLAAYLVPRSATQDHDALRDALKSHLKASLPD
YMVPAHLVILEAMPLTPNGKLDRKALPAPDVSLSQQDYQAPQTEMEQQLASIWADVLKVE
RVGITDNFFELGGHSLLATQVVTRAQKLLQRNVPLRAMFEFNTVQALAEHLQSLGEPQVD
EQKFDRLTDLMAELEGL
NT seq 13014 nt NT seq  +upstreamnt  +downstreamnt
atcatggatgcgtttgaactccccgacaccctggcccaggcccttcagcgtcgcgcttcg
caaacgcctgatcgtctggccctgcgtttcctcagcgacgaggaaagccagggtctggtg
ttgacctaccgtgatctggacctgcgcgcacggaccatcgccgccgcgctgcaaggtcag
accgtgccgggggatcgggcgattctgctgttccacagcgggccggattatgtcgccgca
tttttcggctgcctgtatgccggggtcattgcggtgccggcctacccgccggaatccaat
cgccgtcatcatcaggaacggctgctgtcgatcattgccgatgccgagccacggctggtg
ctgaccggctccgatgtgcagcctgccttgctgcagatggatgagctggctgctgccgat
gcgccgccactgctttgtgtcgatacgctggacagcgcgtcggcgcaaggctggcaaggg
ccgcatctgcaagccgacgatatcgctttcctgcagtacacctcaggttcgactgctttg
cccaagggcgtgcaggtcagtcatggcaatctggtcgccaatgagctgttgatccgccac
ggcttcggcatcgacgtcaacccggacgacgtgatcgtcagctggctaccgctgtaccac
gacatgggcttgatcggcggcttgttgcagccgattttcagcggggtgccgtgcatcctc
atggcgcctgcctacttcctcactcggccgttgcgctggctggaagcgatcagcgaatac
ggcggcaccatcagcggcgggccagacttcgcctaccaattatgcagcgcacgggtcagt
gattcggcgctggagcggctggacttgagccgttggcgcgtggcgtattccggctccgag
ccaatccgcgaagacagcctgaatgcgtttgccgagaaattcgccagctgcggctttacg
ccggacagcttcatggcgtcttacgggctggccgaagcgacgctgtatgtggccggaggc
aagcgcggcaagggtattccttcgctgcgcctgaatgcgcaggcgctgtcgcgcaacgtg
gccgagctgggtgacgggcagccggtcatgagctgcggcagcggccagccggggcatggg
gtattgatcgccgatcccgtcacgctgcaggctctggacgaaaacagtattggcgaagtc
tgggccagcgggccgagcatcgcccatggttactggcgcaacccgcaagccaccgctaac
accttcgtccagcatgacggccagatctggctgcgcactggcgatctgggttttcagcgc
cacggcgagctgtacatcaccggacgcttgaaagacatgctcatcgtgcgcggccacaac
ctgtacccgcaggacatcgaaaaggtgatcgagcgcgaaatcgacgtggtgcgcaaaggt
cgggttgccgcgttcgccgtcaatcaggatggcagcgaaggcattggcattgccgccgaa
atcagtcgcagcgtgcagaaagtttttccgcccgaagcactgatcaaggtcatccggcag
actgtggccgaggcttttcaggaagcgccgagcgttgtggtactgcttaatccgggcgca
ttgccgaagacctccagcggcaaattgcagcgttcggcctgccgcacccgactggccgac
ggcagcctcgacagctacgcggtatttcctgcggctgataccgctcttcaaaacagtgca
cgaagcgctggttcggacctgcaagcgcagatcgccagcgtctggtgcgagcagttgcag
tgcgagcaggtcagcgccgacgaccatttctttctgctgggcggcaactcgattgttgcg
actcaggtcgtggcgaggttgcgcgagacgctgggcatcgacctgaacctgcgcctgctg
tttgaagcgcctactttgtcagcctttgctgcccggatcgaagcgctgcagatcaccgca
gagcagggcgacaacccgacgcagaacgctatcgtccgtcttccgggcaacgagcatctg
ccgcaatcgctggcgcagaaccgcttgtggttcctctggcaactggacccggccagcagc
gcctacaacattcccggcgggctgcacctgcgtggcgagctgcatgtcgaggcattgcgc
agcagcttccagcgcctgatcgagcgccatgaatcgctgcgcacgcgtttctacgagcag
gacggcgtggccctgcaacgcatcgatgcgcccggcgagtttcagttgcaccgcatcgac
atcagcgacctgtcaggcgatgaacgccaagcgcgtgcgctggcgattcgcgaagagcag
gcgcgcctgccgttcgatctgcaaaacggccccttgctgcgcgtcacgctgctgcaactg
gatgaggaagagcatcagttgctggttacgctgcaccacatcattgctgatggctggtcg
ctgaatgtgctgatcgatgagttctcgcgcctctatgcatcggccgttcagggccagagc
ctggaactggcgcctttgccactgcgttacgctgactacggccagtggcagcgcgaatgg
ctggcgcggggcgaggccgagcgccagctcgactactggaaacaacagttgggcgatgaa
cagccgacgctgatgctgaacacagaccacccgcgttcgctacgccgtcaacacagcgcc
tcgcgctacagcgtgcgcctgagcgccgagctgagtgccgccgtgcggaacactgcgcaa
gcctggcaatcgacgccgttcatgctgttgctggccggtttccagaccctgttgcatcgc
tacagcgggcagaccgacattcgcatcggcgtgcccggtgccaaccgtccgcgccatgaa
acccaaggcctcatcggcttcttcatcaacaccctggtgctgcgtgcgcaactggacccg
cgcctgccgttttcgacgctgctggcccagacccgccaggccgcactggacgcccaggcg
catcaggacgtgccgttcgaacaactggtcgaagccttcccgcacgcccgtgagcacggc
ttgtttcaagtcatgttcaaccatcagcagcgcgacctcggcgccttgcgtcgtttgccg
ggtctgctcgccgaagaactcccgtggcacagccgcgaggccaagttcgacctgcaattg
cacagcgaagaagaccgtaacggtcgcctgaacctgtccttcgactacgccgacgagttg
ttcgagcgcgataccatcgtgcgtctggccaagcactatgtgcagttgctgacccaggtc
agccagcaggcgcaggtcgcgctgggcgacgtgcagttgctcaacgctgaagagctggcc
gaacaagcgcagtggagcgcggcaccctgcgcgcctgcgcaggtgtggttgccagaatta
ctggaacgtcaggtgctacagaccccggaacgcattgcgctggtgtgggagggcggcagc
ctcgatttcgccgacctgcacgcgcaggccaaccgcctggcgcattacctgcgtgacaag
ggtgtcggcccggatatcaaggtggcgattgccgccgagcgttcgccgcaactgttgatc
gggctgctggcgatcctcaaggccggtggcgcctacgtgccgctggacccggattacccg
actgatcggctggcctacatgctgcaagacagcggtgtcgagttgctgctgacccagagc
catttgctcggcgatctgccgagcgccgagggcgtctgcacgctggccatggacacgctg
cacctggacaactggccgatcagcgcgccgggcctgcacctgcacggcgaccatctggcc
tacgtaatttacacctcgggctcgaccggtcagcccaaaggcgtcggcaacacccacgcg
gcgctggtcgagcgcctgcaatggatgcaggccacctatgcgctggacgaaagcgatgtg
ctgatgcaaaaggccccgatcagtttcgatgtgtcggtgtgggaatgtttctggccgctg
atcaccggcagtcgtctgctgctggccggccccggtgaacaccgcgacccgcaccgcatt
gcccaactggtcaacgaatacggcgtgaccacgctgcatttcgtgccgccactgctgcaa
ctgttcatcgacgagccactgacgcagcactgcagcagcctgcgtcgcctgttctccggt
ggcgaagcgctgccgagcgagctgcgtaatcgggtgctggagcaactgccgaacgtgcaa
ctgcacaaccgctatggcccgaccgaaaccgcgatcaacgtcacccactggcagtgccgg
cttgccgatggtctgcgttcgccaatcgggcgtccgctgggcaacgtgctgtgccgggtg
ctggacagcgaattcaatccgctgccacgcggggttgccggcgagctgtgcatcggcggc
atcggtctggcgcgtggctacctgaaccgtccgggcctgactgccgagcgcttcatcgcc
gatccgctggggcaagcgggtgagcgcctgtatcgcaccggggatttggtacgctggacc
tccgatggcgcgctggaatacctcggccgcctggatcagcaggtcaaactgcgcggcttt
cgtgtcgaaccgcaggaaatcgaagcccgattgctggctcaacagggcgtaggccatgcc
gccgtgctggttcgcgaaaccgctgctggcccgcaactgatcggctactacaccgccgaa
gccgggcaggacgttcaggccgagcgcctcagatcggcactggccctggagctaccggat
tacatggtcccggcgcaactggtgcgcctcgacagcatgccgctgaacccgagcggcaag
ctggatcgccgcgccttgcccgagccgcagtggcagacccgcgagcacgtcgagccgcac
acgaatctgcaaaaacagatcgccactatctggcgtcaggtgctgggcgtgccgcgtgtc
ggcctgcgcgatgactttttcgaactgggcgggcattcgttgctggccacacagatcatt
tcccgcgtgcgtcaggcctgcgacatcgacctgccgctgcgcgctctattcgaagccagc
gagttgggcgcgtttgtcgaacaggtgcaaaccattcaacagtcgggcgcacgcagcagc
ctgcaaccgattgcccgtgtcgaccgcagccagccggtaccgttgtcctattcgcagcag
cgcatgtggttcctctggcagatggagccggacagcccggcctacaacgtcggcggcatg
gcgcgcctgaacggtgtgtttgatatccagtgtttcgaggccgcgctacaagccttgatc
atgcgtcacgaaaccttgcgcaccacctttccgagcgtcaacggcgtggcctgtcagaaa
gtctctgaacagaccggcctgagtgtgcaatggcaggactattcagcgctgcctgttgac
gtccgtcagcagcgccttcaggcgctggctgacagcgaggcgcatcaacctttcgacctg
gaagccgggcccttgctgcgcgcctgtctggtcagggccgccgagctggagcattacttc
gtcctgaccctgcaccacatcgtcaccgaaggctgggcgatggatattttcgcccgcgaa
ctgggcctgctctacgaagcgtttcttgaaggtaaaccgtctccgctggagccgctggcg
gtgcaatacctcgattacagcgtctggcagcgtcagtggatggaggcgggcgagcgtcag
cgccaactggattactggaccgcacaactgggcaacgaacacccgctgctggaactgccc
ggcgaccgcccgcgtccgcccgtgcaaagccatcaaggcgagctgtaccgcttcgatctg
agtcccgagctggccgccaaagtacgcgccttcaatgcgcgtaatggcctgaccctgttc
atgaccatgaccgccacgctggcagtcttgctctaccgttacagcggccagaatgacctg
cgcatcggcgcaccggtggccaaccgcattcgcccggaaagcgaagggctgatcggcgcg
ttcctcaatacccaggtgctgcgcgttcagctcgatgggcagatgagcgtcgcacagctg
ttcgaacaggtgcgccacacggtcatcgaaggccagtcgcatcaggacttgccgttcgat
cacctggtcgaagctctgcaaccgccacgcagcgccgcctacaacccgctgttccaggtg
atgtgcaacgtgcagcgttgggagttccagcaaagccgcgagctggcgggcatgaccgtc
gactacctggtcaacgatgcgcgtgccaccaagttcgacctcaacctggaggtcaccgag
ctggatcatcgtctgggttgctgcctgacttacagcactgatctgttcgacgaaccgcgt
atcgcgcagatggccgggcactggctgaacctgctgcaagcgctgctcgtcgatccgcag
caacgcctgagcgaactgccgttgttgcaggatgccgagcgtcagcagttgctcgacagc
ctcggcgtcgaagccggcgggcaacgtctcgatcagtgccttcacagcctgttcgccgag
cgggcccggttgcgggcaaatgcaccggcgctgacctttgccggcgaaaccctgagctac
gccgagctggacgcccgcaccaaccaactagcatggatgctgcgcgagcgcggtgtcggc
ccgcaggtgcgtgtcggcctggccttgccgcgctcgctggacatggtggtcggcctgctg
gcgatcctcaaggccggtggcgcctacgtgccgctggacccggaatacccgctggaacgc
ctgcattacatgatcgaagacagcggcgtcggcctgctgctgagcgaccgagcgctgttc
gcagcgttaggcgagttgcctgccggtgttgcccgttggtgcctggaagacgatcagccg
tcgctggcgtctttctcgtccgatgaactgccgtttatcagcctgccgcagcatcaggcg
tacctcatctatacctccggttcgaccggcaagcccaaaggtgtagtggtgtctcatggc
gaaatcgccatgcactgtcagtcggtgatccgtcgtttcgacatgcgccctgacgactgc
gagctgcacttttattcgatcaatttcgacgccgccaccgaacgtctgctggtgccgttg
ctcagcggtgcacgtgtggtattgcgcgcccagggccagtgggacgccgaagaaatctgc
acgctgattcgcgagcagcaggtcaatattctcggtttcacgcccagctacggcagccag
ttggcgcagtggctggcgactcagggccagaccttgccggtgcgcatgtgcatcaccggc
ggcgaagcgctgactggcgaacacttgcagcgtatccgtgcggtgttccagcccgagctg
ttgttcaatgcctacggcccgaccgaaaccgtggtcatgccgctggccagcctggccccg
caacagctggaggagggcgaagccagtgtgccgattggccgtgtggtcggcgcgcgggtt
gcctatattctcgatgctgatctggcgctggtgccgcagggtgccagtggcgagttgtac
atcggtggcgctggtctggcgcagggctatcatcagcgccccggcatgactgccgagcgt
ttcgtggccgatccgttcgccactaacggtgggcgtctgtaccgcaccggcgatctggtg
cgcctgcgtgccgatgggctggtggagtacctggggcgtatcgaccatcaggtaaaaatt
cgcggtttccgcatcgaactgggtgaaatcgaaacccgtttgctggagcaccaagcgatc
cgcgaagccatcgtgttggcgctggacacgccgtcgggcaagcaactggcaggctatctg
gtcagcgatgtggccgggcagggcgatgagcaacaggcacaactgcgtgaatcgctgaag
gcgcacctcaaggcgcaactgccggattacatggtgccgacgcacttgattctgcttgcc
agcatgccgctgaccgctaatggcaaactggaccgacgcgccttgcctgcgccggacccg
gagctcaatcgtcagcactacatcgcgcctgccagcgagctggagcagcaactggcggcg
atctggtgtgcggcgctgaacgtggagaaagtcggccttaatgacaatttcttcgagctg
ggtggcgattcgatcctgtcgattcaggtggtcagccgggcacggcaggcgggtatccat
ttcagcccgcgtgacctgttccagcatcagactgtgcaaaccctcgcggccgtcgcgacc
acccgcgaactgattcacgccgagcaggggctgcttgaaggtgtgtccgccctgacgccg
attcagcactggttcttcgccacgccgatcccgcagcgtcagcactggaaccagtcgctg
gtgctggagccggtcagcgtgctcgatccgcgtgttctggagcaggcattgcgcgccgta
ctggaacagcacgacgccctgcgcctgagcttcaccgaacacgacggcaagtggcaggcc
gaacaccgcgcggtcaccgcagaaaccctgttgattcaggcgcgggtcgcggatctggac
gaatgtgcggctctgtacgccgacacccagcgcagcctcgatctgcaaaacggcccgctg
ctgcgcgccttgctggtcgacgggccgcagggccagcaacggttgctgatggtcattcac
catctggtggtcgacggcgtttcgtggcgtgtgctgctcgacgatctgcaaacggcttat
cgtcaatcaagcgaagccgcgcccgtgcgctttgcagcgaagaccagcgccttccgcgac
tgggccgcgcgcttgcaggcttatgcgggcaacgagtcgttacgtgaagaactgcgcgta
tggaaacgccagctgggcggtcctgcggcgcagttgccgtgccataacccgcagggcggc
cagcagaatcgccacgcgcagaccgtcagcgtgcggctggatgccgaacgcacccggcaa
ctgctgcaacaggcccccagtgcctaccggactcaggtcaacgacctgctgctgaccgcc
ttggcgcaagtggtctgccgctggagtgggcagccttcgaccttgatccagctagaaggt
cacggccgcgaaaacctgtttgacgacatcgacctgacccgcacggtgggctggttcacc
agcgcctatccgctgcgcctgactccagcgctggctgccgacgcggcactgggggactcg
atcaaggccatcaaggaacagttgcgcaaagtgccgcacaaggggctgggctatggcgtg
ctgcgctacctggccgacagtgccagcaaagccgccatgcaggcgctgccggtcgcaccg
attaccttcaattacctcggccagttcgaccagagcttcgccagcgatgcactgttccat
ccactggaagagtcggcgggtgccgctcacgatccgcatgcgccgttgcccaacgaactg
agtatcgacagtcaggtgtacggcggcgaactgctgctgcgctggaccttcagcgccgag
cgctaccaacccgccgctatcgaagcgctggcgcaggattacctgactcagttgcaggcg
ctgattgcccattgcctgagcgatggcagcggcggcctgacgccttccgacttcccgctg
gccgatctggatcaggcgcaactggacgcgctgccggtcccggcaaaccacattgaggac
gtctacccgctgaccccgatgcaggagggcatgctgctgcacaccctgctggagccgggc
accggcctgtattacatgcaggaccgttaccgcatcaacagcgcgctggacccgcagcgt
ttcgctcaggcctggcagatggtcatcgcccgtcacgaagcactgcgtgcctcgttttgc
tgggacatcggcgaaagcatgctgcaggtcatccacaaaccgggcagcaagccgattgat
tacctggactggcgtgacgtgccgtcagaccagcaggagcctcgcttgcaggccctgctc
aagtccgagcgcgagaccggtttcgatctgctcaagcagccgccgttccacctgcgtctg
attcgcgtcgacgaggcgcgctactggttcatgatgagcaaccaccacatcctgatcgat
gcctggtgccgctcgttgctgatgaatgacttcttcgatatctacactgcgctgggcgaa
ggtcgtgacgcacaattggcacctgcgccacgttatcgtgattacatcggctggctgcaa
cgccgcggtctggcgcaggcgcgtgactggtggcagcacaacctgcgtggcttcgaacgg
ccgacgccgatcaccagcgaccgtccgttcctgcgcgaacatgcgggtgacagcggcggc
atggtggtgggtgactgctacacccgccttgatgaacgcgacggcgcacagctgcgcgaa
ctggcccagcagcatcaattgacggtcaacaccttcgctcaggcggcgtgggccttgact
ctgcggcgcatgagcggtgatcgcgacgtggtgttcggcgtgactgtggccgggcggccg
gttgagctgccgcagatgcagcgcaccgtcgggctgttcatcaacaccatcgcgctgcgg
gtcggcatgcccggtgacgagcagcgctgtacggttcgcgattggctgagccaattgctg
gacagcaacatgcagttgcgcgagtacgaatacctgccgctggtgaccattcaggaaaac
agcgagctgcccaagggccagccgctgttcgacagcctgttcgtgttcgaaaacgcgccg
gtggaggtctcggtgctggaccgtgcgcaaagcctcaacgccacctcggattccggtcgt
acccacaccaactacccgctgacggccgtctgctatccgggcgacgaccttggcctgcac
ctgtcctacgaccagcgttatttcgatgaatccaccgtgcagaacatgcttggcgaattc
aaacgcctgctgctggcgctgatcgaaggtttccatggcgacatggccgatctggcactg
gtcagtgagcaggagcgcaccttcctgcttgatggctgcaaccagagcgaccacgcttac
ccgctggacaagagctacgttgaactgtttgaagcgcaggtcgcggcgcatccccagcgc
attgcggtcagctgtctggatcgtcaggtcagctatgccgagctgaacatcaccagcaat
cgactggggcatgctctggtcgaggccggtgtcaggtttgatcatccggtggcgttgctg
gccgaacgcgggccggaactgctcggcatgatcatcggcagcttcaaggccggtgccggt
tacctgccacttgacccggcgctgccgaattcgcgtctgagcggcatcatcggccagagc
cacacgccggtgctggtgtgcagtgcgcagtgtctggagcagggcagggcgttgcttgac
gcgctgcccgaggtgagccggccgcttctgctggtctgggaaaacgtgcagcagagcgag
tcagcgcagcacaaccccggccgctacagcgcgccggacaacctcgcttatgtgattttc
acatcaggctccaccgggctgccgaagggcgtgatggtcgaacagcgcggcatgctcaat
aaccagttgagcaaggtgccgtacctgagcctgagcgaaacagacgtgatcgcccagacc
gcttcgcaaagcttcgacatttcggtctggcagttcctcgccgcgccgctgtttggcgcc
caggtggctatcgtgccgaacgacatcgcccgcgatccacaagcgctgttggcgcatgtg
caggcgcagcgcatcagcgtgctggaaagcgtgccgtcgctgattaccggcctgctcgcc
gaagagtccgccacgctggacagcctgcgctggatgctgccgaccggcgaagccatgccg
ccggagctggccagccagtggctgcaacgctacccgcagatcgggctggtgaatgcctat
ggcccggctgaatgctctgatgacgtggcgttcttccgtgtcgatgcggagtcgacgcgc
agtacgtatctgccgatcggctcgccgaccgacaacaatcgtctgtacctgctcgatgac
gcgctggacctggtgccgctgggcgcagtcggagagttgtgcgtcgccggagcgggtgtc
gggcgcggttatgtggctgatccattgcgcaccgtgccagtcttcatacccaacccgttt
ggctcacccggcgaacgcctgtaccgcaccggcgacctggcaaagcggcgtaaggacggc
gtgctggagtacgtcggccgggtcgaccatcaggtgaagattcgcggttatcgcatcgag
ctgggcgaaatcgaaacccgcctgctggagcatcctgccctccgcgaatcggtggtgctg
gacatcgacgggccgctgggcaaggtgctcgcggcgtatctggtgccgcgctctgcaacg
caggatcacgatgcgttgcgcgacgcgctgaaaagccacctcaaggccagcctgccggac
tacatggtgccggcgcatctggtgattctggaggcgatgccactgacgccgaatggcaag
ctcgaccgcaaggccctgcctgcgccggacgtcagtctgtcgcagcaggattatcaagcg
ccgcagaccgaaatggagcagcaactggcgagcatctgggccgatgtgctcaaggtcgag
cgcgtcgggatcaccgataacttcttcgagctgggcggccattcgctgctggctacgcag
gtggtgactcgtgcgcagaagctgttgcagcgtaacgtgccattgcgggcaatgttcgaa
ttcaacaccgttcaggcgttggccgagcatctgcaaagccttggtgagccgcaggtagat
gagcagaagtttgatcggctgacggacttgatggcggaactggaagggctctga

DBGET integrated database retrieval system