KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_3179Help
Entry
PSTAB_3179        CDS       T01571                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
psz  Pseudomonas stutzeri ATCC 17588
Brite
Enzymes [BR:psz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PSTAB_3179 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3394829..3395410
Genome map
AA seq 193 aa AA seqDB search
MAFELPPLPYEKNALEPHMSAETLDYHHDKHHAAYVTNLNNLIPGTEFEGKDLESIIKTS
SGGIFNNAAQVWNHTFFWNCLAPNAGGQPTGALADAINASFGSFDKFKEEFTKTAIGTFG
SGWAWLVKKSDGSLGLASTIGAGNPMTAGDKPLLTCDVWEHAYYIDYRNARPKFVEAFWN
LVNWDFVAKNFAG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgccgctgccttacgaaaagaacgccctcgagccgcacatgtcc
gccgagacgctcgactaccatcacgacaagcaccacgctgcctacgtgaccaatctgaac
aacctgatcccgggcaccgagttcgaaggcaaggatctggaatccatcatcaagacctct
tccggtggcatcttcaacaacgccgcccaggtctggaaccacaccttcttctggaactgc
ctcgcgccgaacgccggtggccagccgaccggcgccctggctgatgccatcaacgcctcc
ttcggctcgttcgacaagttcaaggaagagttcaccaagaccgccatcggcaccttcggc
tccggctgggcctggctggtcaagaagtccgacggcagcctgggtctggccagcaccatc
ggtgccggcaacccgatgaccgcaggcgacaagccgctgctgacctgcgatgtctgggag
cacgcctactacatcgactaccgcaacgcccgtccgaagtttgtcgaagcgttctggaac
ctggtgaactgggacttcgtcgcgaagaacttcgcaggctaa

DBGET integrated database retrieval system