KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_4061Help
Entry
PSTAB_4061        CDS       T01571                                 

Gene name
nasE
Definition
(GenBank) nitrate ABC transporter permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
psz  Pseudomonas stutzeri ATCC 17588
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:psz00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PSTAB_4061 (nasE)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    PSTAB_4061 (nasE)
Transporters [BR:psz02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    PSTAB_4061 (nasE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4386086..4386955
Genome map
AA seq 289 aa AA seqDB search
MNANVKLQPASTEPVSIVRPSRAAALMQRSGRYAVQQLLPPLVILLVLGVIWEMLCSGAD
AALPPPSQVIAETWELIVDPFYDNGGNDVGLAWQLLASLERVAVGYLLAVVAGVGLGVLI
GQSDWAMRGLDPIFQVLRTVPPLAWLPLSLAGFQDSHPSALFVIFITAIWPIIINTAVGI
RNIPQDYRNVAQVLQLNGFEYFKTIMLPAAAPYIFTGLRIGVGLSWLAIIAAEMLIGGVG
IGFFIWDAWNASRISDIILALVYIGVVGFVLDRLVAFVGQRITRGIPAN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaacgtcaaactgcagcccgccagcaccgagccggtgtccattgtccgccca
tccagagccgctgccctgatgcagcgtagcggccgctacgcggtgcagcagctgttgccg
ccactggtcatcctgctggtgctcggggtgatctgggagatgctctgctccggtgccgat
gccgcgctgccaccgccttcgcaggtgatcgcggaaacctgggaactgatcgtcgatccg
ttctacgacaacggcggcaatgacgtgggcctggcctggcaactgctggccagcctcgaa
cgggtagcggtcggctatctgctggcggtagtcgccggggtcggcctcggcgtgctgatc
ggccagtcggactgggccatgcgcggcctcgatccgatcttccaggtgctgcgcaccgtg
ccgccactggcctggctgccgctgtcgctggcgggctttcaggacagccatccctcggcg
ctgttcgtcatcttcatcaccgcgatctggccgatcatcatcaataccgcggtgggcatc
cgcaacatcccgcaggactaccgcaacgtcgcccaggtgctgcagctcaatggcttcgaa
tacttcaagaccatcatgctgccggccgccgcgccctacatcttcaccggcctacgcatc
ggcgtcggcctgtcgtggctggcgatcatcgccgcggagatgctcatcggcggcgtcggc
atcggcttcttcatctgggatgcgtggaacgcctcgcgcatcagcgacatcatcctcgcg
ctcgtctacatcggcgtggtcggcttcgtactcgatcgcctggtggccttcgtcggccag
cgcatcacccgcggcattccggccaactga

DBGET integrated database retrieval system