KEGG   Paenibacillus terrae: HPL003_01080Help
Entry
HPL003_01080      CDS       T01668                                 

Definition
(GenBank) bacillolysin
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
pta  Paenibacillus terrae
Brite
Enzymes [BR:pta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     HPL003_01080
Peptidases [BR:pta01002]
 Metallo Peptidases
  Family M4: thermolysin family
   HPL003_01080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
225099..226874
Genome map
AA seq 591 aa AA seqDB search
MKKVWVSLLGGAMLLGSVASGASAESSVSEPNQLTPTFHAEQWKAPSSLSGDDIVWSYLN
RQKKTLLGADSTSVRDQFRIIDRTSDKSGVSHYRLKQYVNGIPVYGAEQTIHVDKSGEVT
SYLGAVITEDQQQEATEGTTPKISATEAVYTAYEEAATRIQALPSFDDTISKDAKEQGSV
SKDTYAEASNNEQTTSIDKDKLSLEKAADLKDSKIEAVEAQSSIAKIANLQPEVDPKAEL
YFYPTGDTTRLVYVTEVNILEPAPLRTRYIIDANDGKIVFQYDIINEATGTGKGVLGDTK
SFNTTQSGSSYQLKDTTRGNGIVTYTASNRQTIPGTLLTDADNVWNDPAGVDAHAYAAKT
YDYYKDKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGTTFIAFSGDPDVV
GHELTHGVTEYTSNLDYYGESGALNESFSDIIGNDIQRKNWLVGDDIYTPSIAGDALRSM
SNPTLYDQPDHYSNLYKGSSDNGGVHTNSGIINKAYYLLAQGGTFHNVTVSGIGRDAAVQ
IYYSAFTNYLTSTSNFSNTRAAVVQAAKDLYGANSAQATAAAKSFDAVGVN
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatgggtttcgcttcttggaggagctatgttattagggtcggtagcgtct
ggtgcatctgcggaaagttccgtttcggagccaaatcagcttacgccaaccttccacgcc
gagcaatggaaggccccttcatcgttatcgggtgacgacattgtatggagttatttgaat
cgacaaaagaaaacgttgctaggtgcggacagcaccagtgtccgtgatcaatttcgcatt
attgatcgcacgagcgacaaatccggtgtaagtcattatcggctgaaacagtatgtgaac
gggattcccgtatatggagctgaacagacgattcatgtggacaagtctggtgaagttact
tcttatctgggggccgtgattactgaggatcagcaacaagaagctacagaaggtacaact
ccgaaaatcagcgctaccgaggccgtctataccgcgtatgaggaagccgctacacggatt
caagccctcccttccttcgacgatacgatctctaaagatgctaaggagcaaggcagtgta
agtaaagacacttacgcagaagcttctaacaacgagcaaacaacctctattgataaggac
aagctaagtcttgaaaaagcagctgatttgaaggacagcaaaattgaagctgtagaagca
caaagctccatcgctaaaatcgccaatttacaacctgaagtagaccccaaagctgagctg
tacttctatcctactggcgatacgacgcgtctggtttatgtaacagaagttaatattttg
gagcctgcgccgctgcgtacacgctacatcattgatgccaatgatggcaagatcgtattc
cagtatgacattattaatgaagcgacgggcacaggtaaaggtgtgcttggtgataccaag
tcgttcaacactacgcagtccggaagcagctatcagttaaaagacacaacacgcggtaac
ggaatcgtgacctacacggcctccaatcgtcagaccattccaggtacgctcctgacggat
gccgataacgtatggaatgatccagccggcgtagatgctcatgcttatgcggccaaaaca
tatgattactataaggacaaattcggacgcaacagtattgatggacgtggcctgcaactc
cgttcgacggtccattacggcagccgctacaacaacgccttctggaacggctcccaaatg
acttatggagacggggatggtaccacatttatcgctttcagtggtgatcccgatgtagtt
ggtcatgaactcacgcacggtgttacagagtatacttcgaatttggattattacggggaa
tctggtgcgttgaacgagtccttctcggacatcatcggcaatgacatccagcgtaaaaac
tggcttgtaggcgatgatatttatacgccaagcattgcaggtgatgctctgcgctctatg
tccaaccctaccctgtacgatcaaccagatcactattccaacttgtataaaggcagctcg
gataacggtggcgttcataccaacagcggcattattaataaagcatattatctgttggca
caaggcggtaccttccataacgtaactgtaagtggaattggtcgcgacgcagctgtccaa
atttactatagtgcctttacgaactacctgacttctacttccaacttctccaatacacgt
gctgctgtggtgcaagccgcaaaagacctctacggtgcgaattcagcgcaagcaaccgca
gccgccaaatcttttgacgctgtaggagttaactaa

DBGET integrated database retrieval system