KEGG   Pyrenophora teres: PTT_06674Help
Entry
PTT_06674         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
pte  Pyrenophora teres
Pathway
pte00250  Alanine, aspartate and glutamate metabolism
pte00280  Valine, leucine and isoleucine degradation
pte00410  beta-Alanine metabolism
pte00640  Propanoate metabolism
pte00650  Butanoate metabolism
pte01100  Metabolic pathways
Module
pte_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PTT_06674
   00650 Butanoate metabolism
    PTT_06674
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTT_06674
   00280 Valine, leucine and isoleucine degradation
    PTT_06674
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PTT_06674
Enzymes [BR:pte01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PTT_06674
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     PTT_06674
Amino acid related enzymes [BR:pte01007]
 Aminotransferase (transaminase)
  Class III
   PTT_06674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: EFQ95366
UniProt: E3RFY9
LinkDB All DBs
Position
Unknown
AA seq 513 aa AA seqDB search
MASLLRTAGRVRTAVPRCTVGITSRAPIAARHQRRYASAAAAAVADSEEQLFFPDEPRLP
IVNTEIPGPNSKKEIERLSKVFDTRSLNMMADYSQSYGNYIADLDGNVLLDVYAQIASIP
VGYNNPSLLLAATSPEMASAIINRPALGNFPQHDWAEILETGVLSVAPKGLNQVFTAQAG
SDANELAYKAAFMWKRQQQRGGASAEFSEEDITSSMNNKAPGAPDMSILSFKTGFHGRLF
GSLSTTRSKPIHKLDIPAFDWPQAPFPLLKYPLHAHAAENAAEEARCLAETERLLTTFHH
PPAAVVVEPIQSEGGDNHATPAFFRGLRALTKKHDVMLIVDEVQTGVGATGKFWAHEHWG
LDTPPDMVTFSKKAQTAGYYFGNDALRPNKPYRQFNTWMGDPARAILFRSIIQEIQRLDL
VANTAATGDYLYAGLQRLSERFPAEIMNLRGKGQGTFIAFDSGRRDEVLRKAKGKGVNIG
GSGERAVRLRPMLIFQKRHADLLLERLERVFLE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgctaaggacggctgggcgcgtgaggacggctgttccgcgttgtactgtg
ggtattacttctcgggcgccgattgctgctcgtcaccagagacgatatgcttcggcggca
gcggccgccgttgcagacagcgaagagcagcttttcttccccgacgagcccagactgcct
atcgtgaacacggagattcctggcccgaacagtaaaaaggaaatcgagaggctgagcaag
gtgtttgacacaagaagcttgaatatgatggcggattactcgcagagttacgggaattat
attgcggatctagacggcaacgtacttttagatgtgtacgcgcaaatcgcgtctatcccc
gtaggctacaacaacccatctctcctccttgccgccacatcccccgaaatggcgtccgcc
atcatcaacaggcccgccctcggaaacttcccgcagcacgactgggccgagatcctagaa
accggtgtcttaagtgtcgcccccaaaggcctcaaccaagtgtttaccgcacaagccggt
tccgacgccaacgagctcgcctacaaagccgccttcatgtggaaacggcaacaacaacgc
gggggcgcatccgccgagttctccgaagaagacatcacctccagcatgaacaacaaggcg
cctggcgcccccgacatgtccattctatctttcaaaaccggcttccacggccgcctcttc
ggctccctctccaccacgcgctcaaaacccatccacaaactcgacatccccgccttcgac
tggccccaagctcccttccccctgctaaaatacccgcttcacgcccacgctgctgaaaac
gcggcagaagaagcccgctgtctcgccgaaaccgagcgtctactaacgaccttccaccac
ccgcccgccgccgtcgtcgtcgaacccatccaatccgaaggcggcgacaaccacgccacg
cccgccttcttccgcggcctgcgcgccctaaccaagaaacacgacgtaatgctcatcgtc
gacgaagtgcaaacgggcgtgggagccacgggcaagttctgggcccacgagcactggggc
ctagacacgccaccagacatggtgacgttttccaaaaaagcacaaaccgccggctactac
tttggaaacgacgcgctgcggcccaacaagccgtaccgccaattcaacacgtggatgggc
gaccccgcccgcgccatcctcttccgctccatcatccaggaaattcagcgcctcgacctc
gttgccaacacggcggccacgggcgattacctgtacgccggcttgcaaaggctgagcgag
aggtttcccgccgagattatgaatcttaggggcaagggccagggcacgtttattgcgttt
gatagtggccgtagggatgaggtgcttaggaaggcaaagggcaaaggggttaatattggg
gggtccggcgagagggcggttaggttgaggccgatgcttatttttcagaagaggcatgcg
gatttgttgttggagaggttggagagggtgtttttggagtag

DBGET integrated database retrieval system