KEGG   Pyrenophora teres: PTT_14494Help
Entry
PTT_14494         CDS       T01613                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pte  Pyrenophora teres
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTT_14494
Enzymes [BR:pte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PTT_14494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 587 aa AA seqDB search
MLLLNRLAALLFSVTSVVNAADTAAWKSRSIYFVLTDRIARSSSDAGGSACSNLGNYCGG
TFKGLQAKLDYIQGLGFDSIWITPVVSNKAAGYHGYWAEDLYKINSNYGTAADLKSLTAA
AHAKGMYVMVDVVANHMGPGAVTANQPAPLGQSSSYHTPCAIDYSNQNSVEVCEIASLPD
INTSLTSVRDTFKTWISYLVKEYSFDGVRIDTVKHVEKDFWPGFATAAGVYSIGEVFDGD
PTYLAQYAKLMPGLLNYAVYYPMNNFYQQKGSSQALVDMMNTVSNTFPDPSALGTFLDNH
DNKRWLAVKNDKTLLTNCLAYVILARGIPILYYGTEQGYAGGDDPANREDLWRSSFSTNT
DMYQNIKKLTAARKSAGGLGGNDHVHLYVAATAYAWSRAGGNLVVLTTNSGSTSNAQHCF
NTQKANGRWTDVYGSQGTVTADGSGNICVNVKNGNPVVLLASSGTPTTGTTLTTRTATGV
ATGCPTTVSVTFTDRVVTVPGDTIKMTGNTAQLGNWTPANGLTLSAASYTSSNPIWTITV
PLAAGSTIQYKFAKISSGGTIAWENDPNRSYTAPKCQASDSVNTTFQ
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgttgttactcaaccgccttgccgcccttctcttctcagtcacttctgttgtcaacgcg
gctgatactgccgcctggaagtcccgcagcatctacttcgtcttgaccgatcgtatcgct
cgcagcagtagcgatgccggtggtagcgcatgcagcaacctcggcaactattgcggtggc
accttcaaaggtcttcaggccaagcttgactacatccaaggactaggttttgattccatc
tggatcactccagtcgtttcgaacaaggctgctggataccatggctactgggcggaggat
ctgtacaaaataaactcaaactatggcacggctgccgacctgaagagcttgacggctgct
gcccatgcaaagggcatgtacgtcatggttgatgttgttgctaaccatatgggccctggt
gctgtgaccgccaaccaacccgcaccactgggccagtcttcatcctaccacactccctgc
gctatcgattacagcaatcagaacagtgtcgaggtatgcgaaattgccagtcttcccgac
atcaacacgtctctcacatcggtccgcgacacattcaagacctggatttcctacctcgtc
aaggagtacagcttcgacggcgtccgcatcgacactgtcaagcacgttgagaaggacttc
tggcccggctttgctactgcagctggtgtctacagtatcggcgaagtgtttgatggagac
ccaacctaccttgcccagtacgccaagctcatgcccggtctactcaactatgccgtttac
tatcccatgaacaacttctaccagcaaaagggctcatctcaagcactcgtggatatgatg
aacaccgtcagcaacacgttcccggatccttcggcacttggtactttcctcgacaaccac
gacaacaagcgttggttggctgtgaagaacgacaagactctgctcacaaactgtctcgct
tacgtcatcctcgcacgtggtattcccattctttactacggaactgagcaaggctatgct
ggtggtgacgacccagccaaccgagaggacctctggcgaagcagcttcagcaccaacacc
gacatgtaccagaacatcaagaagttgacagcagcaaggaagtcagcaggaggtctgggc
ggcaatgaccacgtccatctgtatgtggccgccactgcctatgcctggagtcgcgcagga
ggcaacctcgtcgtcctcaccacaaacagcggaagcacctccaacgcgcagcactgcttc
aacacccaaaaggccaacggcagatggaccgacgtgtacggaagccagggcacagtgacc
gccgatggcagtggcaacatctgtgtaaacgttaagaacggcaacccggtggtcctcctc
gcctcctccggcacacccaccaccggcactactcttaccacacgcacggctactggcgtt
gccaccggatgcccaaccacagtttctgtaaccttcactgatcgcgttgtcactgtcccc
ggcgacaccatcaagatgacaggaaacaccgctcagctaggtaactggaccccagccaac
ggcctcaccctttcggcagctagctacacctcaagcaacccaatctggaccatcacagta
ccattggctgctggatcaaccatccagtataagtttgcaaaaatcagcagcggaggtacg
atcgcctgggagaacgacccgaaccgctcttacactgcgcccaagtgccaagcaagcgac
agcgtgaacactacgtttcaatga

DBGET integrated database retrieval system