KEGG   Pyrenophora teres: PTT_17206Help
Entry
PTT_17206         CDS       T01613                                 

Definition
(RefSeq) hypothetical protein
Organism
pte  Pyrenophora teres
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 717 aa AA seqDB search
MQQASSPVLQQQLRSLHPGALQTLHQSADGTLYPHTHNHAGILPDLQTLHTTDVYQQQYA
LSGPPPPPPPPLSHPHPLPVHFEQNALPSSASYPPFQAADYQHAESPRFMNPPPLQEHAH
AHTHTHAHAHAQQYHHQVHASPSQTVPRPIQQLPLPLPAPPILPHRIQQSPPPQQHQQQH
QQHQQHQQHQQQQQQQQHEGRHGDETPLSNHGQFQGLKLIAHPPDLDEWREKLFHVDDII
TLTEEQFQTYFPHIDNVYSHRSTQRHKRKRFVSHYWDCRLKGRPPGTKKSTDPDKKKRRR
VARERDLCDVKIKITEFFDRAEYEEQLGQPPPGVVDDPTSPIAPNVPGEVAHIGNPNQNP
HFFGQGQLLSQQPTPGWDMPPNLGAQSNLNIPYAPQTGPLPKKFYTFQRVNGNGGNGKGD
GVAGPHKHTLEESDRVKKNSVLRWQAKVDKDDRKRALGGDSSKKTYHKKATGNALTTAKV
HSKEDELKLYGSAFCPFVQRVWISLEHKQLPYQYIEVDPYKKPQSLLEVNPRGLVPALRH
GPSWSTHESTVIMEYLEDLNAGPSLLPPDAQTRATSRLWADHINRNIIPYFYKLLQAQDQ
TDQIEHAKELRSQISKLVDAAHPTGPFFLGPHISFVDVQIAPWVIRLRRVLGPYRGWPEA
EEGSRWKSWIDAIESDRSVIMTTSTDELYLDSYERYAENRPGTSMLADAVNSGRGLP
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagcctcctcgcctgtgctgcagcagcagctccgatcgctgcacccgggagct
ctccagacgctccaccagtcggcggatgggaccctctaccctcacactcataaccatgca
ggtattctgcccgacctccagacgctccacaccaccgacgtctaccaacagcagtatgcg
ctgagcgggccgccaccaccaccaccgccgccattgtcgcatccgcatccgctgccggtt
cattttgagcagaatgcgctgccatcttcagcctcgtacccgccgtttcaggcggcggac
tatcagcatgcagagagtccgcgattcatgaatcccccgccgctccaagagcacgcccac
gcccacacccacacccacgcccatgctcatgcccaacagtaccaccaccaagtccatgct
tcaccatcccagacagtcccccgccccattcaacaactgcctctaccgctgccagcgcca
cccatactgccccaccgcattcagcagtcgccgccgccccagcaacaccagcagcaacac
cagcaacaccagcaacaccagcaacaccagcagcagcagcagcagcagcagcacgagggc
cgtcacggcgatgagaccccactgtctaaccacggccaattccagggtctcaaactcata
gcacatccaccagacctagacgaatggcgagagaagctgttccatgtcgacgacatcatc
accctgaccgaggagcagttccagacctacttcccccacatcgataatgtttattcgcat
cgctccacgcagcgtcacaaacggaagcgcttcgtctcgcattactgggactgtcggctc
aaggggcgtcctccaggtaccaagaagtctacagacccggacaagaagaagcgcaggagg
gttgccagagagcgggatctatgcgatgtcaagatcaagatcaccgaattctttgaccgc
gccgagtatgaggagcaactgggccaacccccacccggtgtagtggatgacccgaccagt
ccaatagcacctaatgtgccgggagaggtagctcatatcggcaatccgaaccagaatcca
cacttttttggacaaggtcaattgctgtcgcagcaaccgacgccaggctgggacatgcct
cctaatttgggcgctcagtctaacttgaatataccttacgcaccccagaccggccctctc
cccaagaaattctacacatttcaaagggtaaatggcaatggtggaaacggaaaaggcgac
ggtgtcgctgggccacacaaacatacactcgaagaaagcgatcgtgtaaagaagaacagc
gtcctgaggtggcaagcaaaagttgacaaggacgataggaagcgagctctgggcggagat
tcttccaagaagacatatcacaagaaagccactggtaatgccttgacgacagccaaggtc
cattcgaaagaagatgagctcaaattatacggcagtgcattctgtcctttcgtccagcgc
gtgtggatctccctagagcataagcaactcccctaccaatacatcgaggtagatccttac
aagaagcctcaaagccttcttgaagtcaatccacgcggtctcgtccccgctctccgccac
ggcccatcatggtctacacacgagtcaaccgtcatcatggaatacctcgaggacctcaat
gccggccccagcctcttgcccccagatgcccaaacacgcgccacctcgcgcctctgggcc
gatcatatcaaccgcaacatcattccctacttctacaagctcctccaagcccaagaccaa
acagaccagatcgaacacgcaaaggaactccgctcccaaatcagtaaactcgtcgatgcc
gctcatcccactggcccctttttcctcggccctcacatttcttttgttgatgtgcagatc
gcgccttgggttattcggctaaggagggtgttggggccgtatcgcggttggcccgaggcc
gaggaggggagtcgctggaagagctggatcgatgcgattgagagtgacaggagtgtgatt
atgactacgagtacggatgagttatatctggatagttacgagaggtatgcggagaatcgg
ccgggtactagtatgctcgcggatgcggttaatagtgggaggggtctgccatga

DBGET integrated database retrieval system