KEGG   Paraburkholderia terrae: C2L65_00810Help
Entry
C2L65_00810       CDS       T05318                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pter  Paraburkholderia terrae
Pathway
pter00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pter00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    C2L65_00810
Enzymes [BR:pter01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C2L65_00810
Transporters [BR:pter02000]
 Other Transporters
  Pores ion channels [TC:1]
   C2L65_00810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AUT58290
UniProt: A0A2I8EFL9
LinkDB All DBs
Position
1:185528..186145
Genome map
AA seq 205 aa AA seqDB search
MKLYYWPKTRAFRALWMLEEIGEPYELARVNLRAGEQDTTDFHHVNPMCKLPALDDGGVQ
VAESGAVLLYLADRFPEANLGAPVGDPLRGRFLQWLFFTPGCLEPAMAEKMTGASGNSFS
FGWGNLERVKAAIDMALDEGDWLLGERFSAADLLLASTLQIAFVAKLLEPSGRIGEYVER
AITREGHVRAMAIEQREIDALKVKH
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtactactggccgaaaacgcgggctttccgcgcgctgtggatgctcgaagaa
atcggcgagccctatgaactcgcgcgcgtgaacctgcgcgcaggcgagcaggacactacc
gatttccaccacgtcaatccgatgtgcaagctccccgcgctcgacgacggcggcgtccag
gtcgccgaatcgggcgcagtgctgctgtatctggccgaccgttttcccgaagcgaatctc
ggcgcgccagtcggcgatccgttgcgcgggcgtttcctgcagtggcttttcttcacgcca
ggctgtctcgaacccgcgatggccgaaaagatgacgggcgcgtcgggcaattcgttcagc
tttggctggggcaacctggagcgcgtgaaggcggccatcgatatggcgctcgatgaaggc
gactggctgctcggcgagcgcttttccgcagccgacctgctgctggcgagcacgctgcag
atcgcattcgtcgcgaagctgctcgagccgtcggggcgcatcggtgaatacgtcgagcgg
gcgatcacgcgcgaagggcacgtgcgggcaatggcaatcgagcaacgtgaaatagacgcg
ttgaaggtgaagcactag

DBGET integrated database retrieval system