KEGG   Paraburkholderia terrae: C2L65_12375Help
Entry
C2L65_12375       CDS       T05318                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
pter  Paraburkholderia terrae
Pathway
pter00010  Glycolysis / Gluconeogenesis
pter00520  Amino sugar and nucleotide sugar metabolism
pter01100  Metabolic pathways
pter01110  Biosynthesis of secondary metabolites
pter01120  Microbial metabolism in diverse environments
pter01130  Biosynthesis of antibiotics
pter01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pter00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C2L65_12375
   00520 Amino sugar and nucleotide sugar metabolism
    C2L65_12375
Enzymes [BR:pter01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     C2L65_12375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Tex_YqgF Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-ProteinID: AUT60314
UniProt: A0A2I8ENA6
LinkDB All DBs
Position
1:complement(2803864..2804673)
Genome map
AA seq 269 aa AA seqDB search
MAKAKVQTRRNTKSDGERILAIDVGGTGLKAAVIDAGGDMKSERVRVATPHPCTPEQLVD
TLAKLVQPLVDAQHPTLMSIGFPGVVRDNHVLTAPNIGDASWRGFALAEQLAARVGGLPV
RMINDAEMQGFAAIEGHGIEFVLTLGTGAGTALFRDGELMPHLELAHHPVSKDRTYDEYI
GNAAREKVGNKRWNRRVEKVIAILASLVNYDKLWIGGGNAERLTFELPSNAAVVSNAAGI
EGGARLWHPKSVRETRQLPEANQKSGVFG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagctaaagtacagacgcgccgcaacaccaaaagcgacggtgaacggatactc
gccatcgacgttggcggcacggggctgaaggcggccgtgatcgacgcgggcggcgacatg
aaaagcgaacgcgtgcgcgtcgcgacgccgcatccctgcacgccggagcaactcgtcgat
acactggcgaagctcgtgcagccgctcgtcgatgcgcagcatccaaccttgatgtcgatc
ggctttccgggcgtcgtgcgcgacaaccacgtgctgacggcaccgaatatcggcgatgcg
agctggcgcggcttcgcgctcgcggaacaactggcggcgcgcgtgggcgggttgcccgtg
cggatgatcaacgacgccgagatgcagggcttcgcggcgatcgaagggcatggcatcgaa
ttcgtgctgacgctgggcacgggcgcgggcaccgcgctctttcgcgacggcgagttgatg
ccgcatctcgaactcgcgcatcatcccgtcagcaaggaccgcacgtatgacgagtacatc
ggcaatgcggcgcgcgagaaggtgggcaacaagcgctggaaccggcgtgtggagaaggtg
atcgcgatcctcgcttcgctcgtcaactacgacaagctgtggatcggcggcggcaatgcg
gagcgtctgacgttcgagttgccgtcgaatgcagccgtcgtatcgaacgcggcgggcatc
gaaggcggcgccaggctctggcatccgaagtcggtgcgggagacgcggcagttgccggaa
gcgaaccagaagtcgggcgtattcggttga

DBGET integrated database retrieval system