KEGG   Panthera tigris altaica (Amur tiger): 102962904Help
Entry
102962904         CDS       T02988                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102962904 (SETDB2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102962904 (SETDB2)
Chromosome [BR:ptg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102962904 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102962904 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 704 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDSIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
ISNNSTLIKDHTSVIQNEQENKSGSLPSTSYEDSFPEDCTFLSTKNKEIPPLENKAAYIT
GKKSSLNLRYQSHDCSRTCLMKMPLTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYR
TPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVES
VPISFCNEIDNRKLPQFKYRRTMWPRAYYLNSFSNMFTDSCDCSEGCIDITKCACLQLTA
RNAKTCPLSSNKITTGYKYKRLQRQIPTGIYECSLLCKCNRQMCQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDRGTFVCIYSGRLLSRSNTGKPDPTDENGKEENIMKNMFSKKRKI
EVADCEVEVIPLDLETHGSAETEECPPTFRNNLKEPVTEMKCNNISRIQYHSVIRSPKAK
TAIIQHNGKKMGFTSSESVTSEDNDGFKPTQVHLNSKAKEMKKDSSSYQVKDTENSLLIE
SDVIDITKCREEIPSGGRCNQATPLDNQNIIKEFKSQIQKPQGERSPAFQNQQVFCDKEF
PSETKNTSPDSLKKFNKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETRDRNFPLV
AFFTNRYVKARTELTWDYGYEAGTMPEKEILCQCGVNKCRKKIL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaaaactttctggatggagctggaagatgatggaaaa
gtggactccatctttgaacaagtgcaaaatgtgttacaatcactgaaacaaaagattaaa
gatgggtctgccacaaataaagaatacatccaagcaatgattctagtgaatgaagcaacc
ataagtaacaattcaacattgataaaggatcatacatcggtgatccagaatgaacaggaa
aacaaatcaggttcattgccttctacatcatatgaagactcctttccagaagactgtaca
tttctatctacaaaaaataaggaaattcctcctttggaaaataaagctgcatacattaca
ggaaagaaatcatctttgaatttacgttaccaaagtcatgactgctctagaacttgtctg
atgaaaatgccactaaccttcaagggagaaaaccctctgcagctaccaatcaaatgccac
ttccaaagacgacacgcaaagacaaactctcattcttcagcactccacgtgagttataga
accccttgtggaaggagtctacgaaacgtggaggaagtttttcgttacctgcttgagaca
gagtgtaactttttatttacagataacttttctttcaatacctatgttcagttgactcgg
aattacccaaaacaagaagaaattgtttctgatgtggatattagcaatggagtggaatcg
gtacccatttctttctgtaatgaaattgacaatagaaagcttccacagtttaagtacaga
aggactatgtggccacgagcatattatctaaacagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataacaaaatgtgcatgtcttcagttgacagca
aggaatgccaagacttgccccttatcgagtaataaaataaccactggatataaatataaa
agactacagagacaaatacctactggcatttatgaatgcagcctgttgtgcaagtgtaat
cgacaaatgtgtcaaaaccgagttgtgcagcatggacctcaagtgaggctacaggtgttc
aaaactgaaaagaagggatggggagtacgctgcctagatgacattgacagagggacattt
gtttgcatttattcaggaagattactaagcagatctaacactgggaaacctgatcctact
gatgaaaatggaaaggaagagaatattatgaaaaatatgttttcaaaaaagaggaaaata
gaagttgcagattgtgaggtagaagttatcccattagacctggaaacacatggaagtgct
gagactgaggagtgtccacctacattccgtaataatttaaaagaacctgttacagaaatg
aaatgtaacaatatttcaagaattcagtatcattcagtcattagaagtcctaaagccaag
acagccattattcaacacaatgggaaaaagatgggatttacttcctcagagtctgtcacc
tcagaagataatgatggatttaaaccgacccaagtacatctgaactccaaagccaaggag
atgaaaaaggattcaagctcttaccaagttaaagacactgaaaacagtctgctgattgaa
tcagatgtgatagatataaccaaatgtagagaagaaataccatcaggaggaagatgtaac
caagcaaccccactggataatcagaatattataaaggaattcaagtctcaaatacaaaag
ccccaaggggaaagatctccagcatttcaaaaccagcaggtcttttgtgataaagagttc
ccaagcgaaaccaagaacacttcacctgattctctaaagaagttcaataaagggaatgtg
tttttattggatgccacaaaagaaggaaatgtgggccgcttccttaatcatagttgttgc
ccaaatcttttggtacagaatgtttttgtagaaacacgtgacaggaattttccattggtg
gcattcttcaccaacaggtatgtgaaagcaagaacagaactaacatgggattatgggtat
gaagctgggactatgcctgagaaagaaatcctctgccagtgtggggttaataaatgtaga
aagaaaatattataa

DBGET integrated database retrieval system