KEGG   Panthera tigris altaica (Amur tiger): 102965062Help
Entry
102965062         CDS       T02988                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102965062 (TMPRSS9)
Peptidases [BR:ptg01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102965062 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 102965062
NCBI-ProteinID: XP_015399487
LinkDB All DBs
Position
Un
AA seq 823 aa AA seqDB search
MEPTAGDLQLVPGTAKEVPAPYTSCCRMALCVVVATSIIMVTLGVLMASLSTQGVDVEHT
AELQGVRYAHSLQHEASDYYRTLTPALEWLFVSSFRETELEASCVGCTVLSYRDGNSSVF
VHFRLHFLLQASQSLSLGLEEELLRQGLRARLQGHGIPLAAHGTIVSAQLTGSQKAPWTE
RDLKSGHCPENTFSCRNGQCVTKVNPECDDRVDCSDGSDEAHCDCGLQPGWKTAGRIVGG
VEASPGEFPWQVSLRENKEHFCGAAVIGARWLVSAAHCFNGFQDPAEWVAYAGTTHLSGA
EXAHVQPVCLPAATHVFPPRRKCLISGWGYLKEDFLVKPETLQKATVELLDQGLCASLYG
HSLTDRMLCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEAGRPGVYAR
VTRLRDWILEAITTAGRPLAPTAAPASTTASTARPPTPESPTTPTLGLRATSHVAPPSSR
RPSPEPGPHSCAWRPGGSGVSERPLVGSTKVELVRAHLGTASLTGVGGNPVKMGLKRAVL
HPQYNPGILDFDVAVLELAGPLGFNKYIQPVCLPLAIQKFPVGRKCMISGWGNTQEGNAT
KPDILQRASVGIIDQKACSALYNSSLTDRMLCAGFLEGKVDSCQGDSGGPLACEEAPGVF
YLAGIVSWGVGCAQARRPGVYARITRLKGWILDTMSSGLLPTARTPATRQSSGTAAAFTV
PGVPASTATPSATSRATSQPANMTAATVTATAGGQTPLPDPPRTTVGFQPPGTGASGVMC
GWQGSRVGLPTLLMSQGPQCAEGGGRLHQQTLLLTQAGGQKSV
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccgctggtgacttacagcttgtgcctgggacagccaaggaagtcccagct
ccctacacctcgtgctgccgcatggccctctgcgttgttgtggccaccagcatcatcatg
gtcaccctgggagtcctcatggcctccctctctacacagggtgtcgacgtggagcacacg
gcggagctgcaaggggtccgctacgcccacagcttgcagcacgaggcctcggactactac
cgcaccctgacgcccgctctggaatggctgtttgtaagcagcttccgggagaccgagttg
gaggccagctgtgtgggctgcaccgtgctaagttacagggatgggaattccagcgtcttc
gtgcatttccggctgcacttcctgctgcaagcctcgcagtcactgagtctgggcctagag
gaggagctgttgcggcagggactccgagcgaggctgcaggggcacggtatccccctggct
gcccacggcaccattgtgtctgcccagctcacaggaagccagaaagcgccatggacagaa
agagatttaaaatcaggtcactgcccagagaacaccttttcctgccgcaacggccagtgt
gtgaccaaagtgaacccggagtgtgacgacagagtggactgctccgacggatctgatgag
gcccactgtgactgtggtctacagcccggctggaagacagccggccggatcgtgggtggc
gtggaagcgtccccgggagagttcccgtggcaagtcagccttcgagaaaacaaggaacac
ttctgtggggctgctgtcatcggggccaggtggctggtgtccgcggcccactgcttcaac
gggttccaagacccggcggagtgggtggcctacgcgggcacgacccacctcagtggcgca
gagnnggcacacgtccagcccgtgtgcctgcctgccgccacgcacgtcttcccgccgcgg
aggaagtgcctcatctccggctggggctacctcaaggaggacttcctggtcaagccggaa
acgctgcagaaagccacggtggagctgctggaccagggcctgtgtgccagcctgtatggc
cactcgctcaccgacaggatgctgtgtgccggctacctggacgggaaggtggattcctgc
cagggcgactcgggaggccccctagtctgcgaggagccctctggcaggttcttcctggcc
ggcatcgtgagctggggaataggttgtgcggaagccggacgccccggcgtctatgcccga
gtgaccaggctgcgtgactggatcctggaggccatcaccacggcaggccggcctctggcc
cccacggcggctcccgcctccaccaccgccagcactgcccggccccccactcctgagagc
cccaccacgcccaccctgggcctccgggcaaccagccatgtggcccctccgtcctcccgg
cgcccctccccagagcccgggccccacagctgtgcctggcgtcctgggggcagcggggtg
tctgagcggccccttgtcggcagcacgaaggtggagctggtgcgggcccacctgggcacc
gcgtccctcacgggcgtcggcggaaacccggtgaagatggggctcaagcgggcagtgctg
cacccccagtacaaccccggcatcctggacttcgatgtggccgtgctggagctggccggg
cccctgggtttcaacaagtacatccagcctgtctgcctgcccctggctatccagaagttc
cctgtgggccggaagtgcatgatctccggctggggtaacacacaggagggaaacgccacc
aagcctgacattctacagagagcgtctgtgggcatcatagaccagaaggcgtgcagcgca
ctctacaactcctccctcacggacaggatgctctgcgctggcttcctggagggcaaagtg
gactcctgccagggcgactccgggggacccctggcctgcgaggaggcccccggtgtgttt
tacctggcggggattgtgagctggggggtcggctgcgctcaggcccggagacctggcgtg
tacgctcgaatcaccaggctgaagggctggatcctggacaccatgtcctccggcctcctc
cccaccgcgaggacccccgccaccaggcagtcctctgggacggcagctgccttcacagtc
ccgggagtcccggccagcacagccaccccctcggccaccagcagggcaaccagccagccc
gccaacatgactgcagccaccgtaaccgccactgctgggggacagacacccctcccagac
cccccgaggaccaccgtgggcttccagccaccaggtactggggcgagtggagtgatgtgc
gggtggcaggggtcccgtgtgggtctgcccacgctgttaatgtcacaggggccacagtgc
gcggagggtgggggcaggcttcaccaacagacgcttcttctcacccaggctggaggtcag
aagtctgtgtag

DBGET integrated database retrieval system