KEGG   Pelotomaculum thermopropionicum: PTH_0487Help
Entry
PTH_0487          CDS       T00519                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PTH_0487
Enzymes [BR:pth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PTH_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
469336..471216
Genome map
AA seq 626 aa AA seqDB search
MYGYTGNLLRVNLTSGEIKVEKLDEKELRKYMGCTGYAAKLLYQEMPAGVDPLAPEAKVV
FATGAVTGTLCPSGGSYEVCYKSPLTGTWNEARSGGAFGPKLKYAGFDFLVVEGKAEEPV
YLLIKDGRAEIKPAKHLWGLNVEETTDAIINELDDPEVSVAAIGQAGENGVLYAALINDR
GRAAGRGGIGAVLGSKNLKAVVANGSGGIKVARPKEFAEVIDKAEQWLKNYPFAAIPEMG
TVGLLSGNNAMGMLPTRNFQTGFFENADKVAGEVVNRKYQIKRRACYGCSFGCGRYTAVS
GGKFATPPMEGPEYETADMLGPICGVDDIEAIIRGNFLCNVYGLDTISTGISIGFAMECY
ERGLLTDRDTDGIPLRWGDAEAVVKLVEKIAHREGIGDLLALGVKRMAEKLGPRAEDAAI
HVKGLELPAHEPRVESKALAVQYAVSPRGACHMHPNWPSTWDFQVDCGMKDLGIPWPPTG
GMQDESPVKGVAYRYVALQGEISEILGACIFHSWGSEGSCLTPQLYAEIMKALTGWDVTA
EELVTAAERSWNLKRCFNAREGFDRKDDRLPKRISEPIPDGPSAGARVENLDRMLDAYYE
AMGWDRSTGLPTAGKLKELGLEFAVG
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgtacggttatacaggcaatttactgcgggtgaatttgacaagcggcgaaataaaggtt
gagaagctggacgagaaagaactgcgcaagtatatgggctgcacgggctacgcggcaaag
ctgctttaccaggagatgccggcaggcgtcgaccctcttgccccggaagccaaggtggtt
ttcgccaccggggccgtaaccggaaccctctgccccagcggcggcagttacgaggtttgc
tacaagtcgcccctgaccggcacctggaacgaagcccggtcgggcggggcattcggcccc
aagctcaaatatgccgggtttgactttctggttgtggagggcaaggccgaggagccggtc
taccttttaattaaggacggccgggctgaaattaagcctgccaagcacctgtggggcctt
aatgtggaagagactacagatgcgataattaacgagctggacgatccggaagtgtccgtg
gcagccatcggccaggccggcgaaaacggtgtgctgtacgcggcgctgattaacgacagg
ggacgggccgccggccgcggcgggatcggcgcggtgctggggagcaagaacctgaaagct
gttgttgccaacggcagcggcggaatcaaggtggcccgcccgaaagagtttgcggaagtc
atagacaaggcggagcagtggctgaaaaactatccctttgccgccattccggaaatgggc
acggtaggcttgctgtccggcaataatgccatgggaatgcttccgaccagaaacttccag
accggcttttttgagaatgccgacaaggttgccggcgaagtggtcaaccggaagtaccag
atcaaaaggcgcgcctgctatggatgcagctttggctgcggccgctacaccgcggtaagc
ggcggcaagtttgccaccccgcccatggaagggccggagtacgaaacggcggacatgctg
ggcccgatttgcggggttgacgatatcgaggcgataattaggggcaacttcctctgcaat
gtatacgggctggacaccatcagcaccggcataagcatcggctttgccatggagtgttac
gaaagagggctgctgaccgacagggatacagacggaatacccctgcgctggggcgatgca
gaagcggtggtgaaactggtggaaaaaatagcccaccgggagggcattggcgacctgctg
gcgctgggcgtgaaacgcatggcagaaaagctcgggccccgggctgaagacgcggccatc
cacgtcaagggcctggagctgccggcccacgagccacgggtggaatccaaagctctggcc
gttcagtacgccgtatcgccgcggggagcctgccatatgcacccgaactggcccagcacc
tgggacttccaggttgactgcggcatgaaggatctaggcataccctggccgccaacggga
ggcatgcaggacgagtcgccggtcaaaggcgttgcctaccggtacgtggccctgcagggc
gaaatcagcgaaatcctgggcgcctgcatcttccattcctggggcagtgaaggcagttgc
ctgacgccgcagctttacgccgaaattatgaaagcccttaccggctgggacgttactgcc
gaggaactggttactgccgcagagcgctcttggaatctcaagcggtgctttaacgcccgc
gaaggttttgaccgcaaggacgacaggctgcccaagcggatttccgagccgatcccggac
ggtccttcggccggcgccagggttgaaaacctggaccggatgctggatgcttattacgaa
gcgatgggctgggacaggagtaccggcctgcccaccgccggcaagctgaaagagctgggt
ctggagtttgccgtcgggtaa

DBGET integrated database retrieval system