KEGG   Pelotomaculum thermopropionicum: PTH_1243Help
Entry
PTH_1243          CDS       T00519                                 

Gene name
CDC9
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pth00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PTH_1243 (CDC9)
Enzymes [BR:pth01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PTH_1243 (CDC9)
DNA repair and recombination proteins [BR:pth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PTH_1243 (CDC9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1282690..1283664
Genome map
AA seq 324 aa AA seqDB search
MSDGSLPLLRPMLAVSSRPFDSAEYIYEVKWDGYRGLCYLDGNTVIRSRNLADLTGKFPE
LAGMHRKVSRKPAILDGEIVLFEKGKPSFAGLQSRGKISELKSISRASAERPVIFIAFDV
LYCGGKSVMGLSLIERKRLLEEMVGTGEELVLSRYICGEGRKFFEACVKEGLEGAVAKKL
NSVYLPGRRSAYWLKFRHTKEADLVICGYQYGPGGKNLGCLVLGGYHNGRLVYQGKVGTG
FSSEEANALLEGLRRLEVAGETLQVPRAEKSRTRWVRPLLVCAVEYLEATAGGCLRHPVY
RGLRRDKTPAECPAVAIKVWLDGT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacggatccttgcctctcctccggcctatgctggcagtcagctcaaggcctttt
gacagcgcggaatacatttacgaggtaaaatgggacggctatcgcggactgtgctacctg
gacggcaataccgtgatccggtcccgcaacctggccgatttgaccgggaagtttccggaa
ctggccggaatgcaccggaaagtaagccggaagccggctattctggacggggaaatagtg
ctttttgaaaagggaaaaccgtcttttgccgggctccagtcgcggggcaaaataagcgag
ttgaagagtattagccgggcctccgcggagcgcccggttatttttatcgcctttgatgtg
ctgtactgcggcggaaaaagtgtgatggggctgtctctgattgagcgcaaaaggctgctg
gaagaaatggtcggaacgggggaggaactggtgctgtcccggtacatctgcggggagggc
cggaagtttttcgaggcgtgcgtgaaagagggcctggaaggcgctgtggcaaaaaagctg
aacagcgtttatctgcccggccggcgctcggcgtactggctgaaattccgccataccaaa
gaggccgacctggtgatttgcggctaccagtacgggcccgggggaaagaatttaggttgc
ctggttctgggaggctatcataacggcaggctggtttaccagggcaaggtaggaacaggt
ttcagcagcgaggaggctaatgcactgctggaagggcttcgcaggctggaagtcgcaggg
gaaactttacaggttcccagggccgagaaaagcaggaccaggtgggtgcgtccccttctt
gtctgcgccgtggaatatcttgaagcaaccgcaggtggatgcctgcggcacccggtgtac
agggggctgcgccgggacaagacgccggccgaatgcccggcggtagcaattaaagtatgg
ctggacggcacgtaa

DBGET integrated database retrieval system