KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_00095Help
Entry
AOT13_00095       CDS       T04476                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Brite
Enzymes [BR:ptl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AOT13_00095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu AHSA1 FlgD_ig
Motif
Other DBs
NCBI-ProteinID: ALF08571
LinkDB All DBs
Position
complement(18669..19193)
Genome map
AA seq 174 aa AA seqDB search
MFQKAGLLFAAAILFAVGCQKENVTNLEVNMINSAGDSIGTVKLTEQAKGMKLKLDLEGL
PPGEHAIHIHEKGVCTKPDFQSAGNHYNPDGKKHGLLHPEGAHAGDLPNIIVKEDGTVNT
ELTAPNVTLKEGKKGTLLTKDGTAIVIHAGKDDGMTQPAGDAGERIACGEIKNR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcaaaaggcaggtttgttattcgcggccgccattttatttgccgtcggctgccaa
aaggaaaatgtgacgaatttagaagttaacatgataaatagcgccggtgattccatcggc
acggtgaagctaaccgaacaagcgaaagggatgaaattgaagctggatttggaagggctt
ccgcctggtgaacacgcgattcatattcacgaaaaaggagtttgcacaaaaccggatttt
caatcggctggaaaccactacaatccagacggaaaaaaacatggattgcttcatccagaa
ggagcgcatgctggcgacttgcctaatattatcgtaaaagaggacgggacagttaacacg
gaattgaccgcgccaaatgtgacgctgaaagaaggaaaaaaagggacgttgttaactaaa
gatgggacggcgattgtcatccacgccggaaaagatgatgggatgacgcagccggctgga
gatgctggggaacgaattgcatgtggagaaataaaaaatagatga

DBGET integrated database retrieval system