KEGG   Parageobacillus thermoglucosidans: AOT13_03690Help
Entry
AOT13_03690       CDS       T04476                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ptl  Parageobacillus thermoglucosidans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ptl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOT13_03690
  Lipid metabolism
   00071 Fatty acid degradation
    AOT13_03690
  Amino acid metabolism
   00350 Tyrosine metabolism
    AOT13_03690
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AOT13_03690
   00626 Naphthalene degradation
    AOT13_03690
Enzymes [BR:ptl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AOT13_03690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(745083..746105)
Genome map
AA seq 340 aa AA seqDB search
MKAAVVNEFKQKLEIKEVEKPKLNYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVVEVAEGVKSVKVGDRVGIPWLYSACGECEYCLSGQETLCPHQLNGGYSADGGY
AEYCKAPANYVAKIPEHLDPVEVAPILCAGVTTYKALKVSNAKPGEWVAIYGIGGLGHIA
LQYAKAMGLNVIAVDISDEKIELAKQLGADIAINGLKEDPVEAIQQNVGGAHAAISVAVT
KKAFEQAYQSVRRGGCLVVVGLPNEDLPIPIFNTVLNGITVKGSIVGTRKDMQEALDFAA
RGKVRPIVETAPLEKINEVFERMEKGKINGRVVLTIGVNR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggcagttgtcaacgagtttaaacaaaaattagaaattaaagaggtggaaaaa
ccaaagctgaattacggagaggtgcttgttaaaattgaggcttgcggcgtttgccacacc
gatttgcatgcggcgcacggagactggccggtcaagccaaagcttcctttgattcctgga
cacgaaggggtaggcatcgtcgtcgaggtggcagaaggggtaaaatcggttaaagtagga
gaccgtgtcggcattccatggctgtactccgcttgcggagaatgtgaatattgtttgagc
gggcaagaaacgctttgtccgcatcaattaaatggcggatattctgccgatggaggatat
gcggaatactgcaaagcgcctgccaattatgtcgcaaaaattccggaacacttggatccg
gtggaagtcgcgcctattctttgcgcgggggtaacgacatacaaagcgctaaaggtatct
aacgccaaaccgggagaatgggtcgccatttacggaatcggagggttagggcatatcgcc
cttcaatacgcgaaagcaatgggattaaacgtcatcgcggtcgatattagcgatgaaaag
atagagcttgcgaaacaattaggcgctgatatcgccatcaatggacttaaagaagatcct
gtggaagccatccagcaaaacgtgggcggagcgcatgccgccattagcgttgccgtcacg
aaaaaagcgttcgaacaagcctatcaatccgtgagacgcggcggatgccttgttgttgtc
ggtctgcctaatgaagacttgccaattcctattttcaacacagtattaaatggaataacg
gtgaaaggatccatcgtcggcacgagaaaagatatgcaagaagcgttggatttcgccgcg
cggggaaaagtgcgcccgatcgtcgaaaccgctccattggaaaaaatcaatgaagtattt
gaaagaatggaaaaaggaaaaattaacggccgagtcgttttaaccatcggtgtcaaccgt
taa

DBGET integrated database retrieval system