KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_07025Help
Entry
AOT13_07025       CDS       T04476                                 

Definition
(GenBank) alpha-amlyase
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1422205..1423737
Genome map
AA seq 510 aa AA seqDB search
MGNRVFALFILPCLLFYAFPVQAAEKEERTWQDEAIYFIMVDRFNNMDPSNDYNVNVNDP
KGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFKNEPGGYHGYWIQDFYKVDPHFGTMEDL
KTLVKEAHKRGMKVILDFVANHTGYHHPWLNDPAKKDWFHEKKEIFDWNNQKQVENGWVY
GLPDLAQENPEVKRYLIDAAKWWIKQTDIDGYRLDTVRHVPKSFWQEFSKEVKSVKKDFF
LIGEVWSEDPRYIADYGKYGIDGFIDYPLYNAVTKTLTKRDQSLRSLYDVWEYNKTFYDR
PYLLGTFLDNHDTVRFTKLAIDNRQNPISRIKLAMSYLFSAPGIPIMYYGTEIAMNGGED
PDNRRLMDFRADREIIDYIKKLGELRQKLPSLRRGDFTLLYEKDGMAVFKRHYKDETTVI
AINNTGKTQKVHITNDQLTPGKELRGLLAGDLVRSGRDGYDIIINRETAEIYALADKTGI
NIPFIMAIVAVYVLFILFLYLVKRRSKQAT
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggggaatcgagtattcgctctgtttatacttccgtgtcttcttttttatgcgtttccg
gtacaagccgctgaaaaagaagaacgaacctggcaggatgaagcaatttatttcatcatg
gttgaccgctttaacaacatggacccaagcaatgattacaatgtcaacgtcaatgacccg
aaaggctatttcggcggtgatttaaaaggagtgactgccaaactggactacattaaagag
atggggtttacggcgatttggctcacgccgattttcaaaaacgaaccgggcgggtaccat
ggctattggattcaagatttttacaaagtcgatccgcactttggcacgatggaagattta
aaaacattagtcaaggaagcgcataaacgcgggatgaaggtcattttagactttgtcgcc
aatcatacggggtatcatcatccatggctgaatgacccggcaaaaaaggattggttccat
gagaaaaaagaaattttcgattggaataaccaaaagcaagtagaaaacggctgggtgtac
ggcctcccggatttggcgcaggaaaatccggaagtgaagcgctatttgattgatgcggcg
aaatggtggattaaacagactgacatcgacggctaccgcttagatacggttcgccatgtg
ccaaagtcattttggcaggaattttccaaagaagtgaagtccgtaaaaaaagatttcttc
cttattggtgaagtatggagcgaggacccgcgctatatcgctgattacggcaaatatggc
attgacggatttatcgattacccgctttataacgcggtaacgaaaacactgacgaagcgc
gatcaatcgttgcgttcgctttacgacgtatgggaatataacaaaacgttttatgaccgt
ccgtacttgcttggcacgtttttggacaaccatgatacggtccggtttacgaagctggcg
attgacaatcggcaaaatccgatttcacgaatcaagcttgctatgtcttatttgttctcc
gctcctggcattccgattatgtattacggaacggaaatcgcgatgaatgggggagaagac
ccggataaccgccgtttaatggattttcgcgccgaccgggaaatcattgattatattaaa
aaacttggcgaattgcggcaaaaacttccttccttgcggcgcggtgattttacgttgctg
tatgaaaaagacggcatggccgtatttaagcgccattacaaagacgaaacaacggtgatc
gccattaataatacaggaaaaacacaaaaggtgcatatcacgaatgaccaactgacgccg
ggaaaagagctgcgcgggctgcttgccggcgatttagtgcggagcggccgcgatggctat
gatattattatcaatcgcgaaacagcggaaatttacgcgcttgccgataaaacagggatc
aatattccttttatcatggcgattgtcgctgtttacgtattatttatcctatttttgtac
cttgttaaaaggcggtcgaaacaggcgacgtaa

DBGET integrated database retrieval system