KEGG   Pan troglodytes (chimpanzee): 107967672Help
Entry
107967672         CDS       T01005                                 

Gene name
SETD8
Definition
(RefSeq) N-lysine methyltransferase KMT5A
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107967672 (SETD8)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107967672 (SETD8)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107967672 (SETD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
12
AA seq 352 aa AA seqDB search
MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSP
NKCSGMRFPLQEENSVTHHEVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDAR
RGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRK
LTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGD
FVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHS
KCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctagaggcaggaagatgtccaagccccgcgcggtggaggcggcggcggcggcggcg
gcggtggcagcgacggccccgggcccggagatggtggagcggaggggcccggggaggccc
cgcaccgacggggaaaacgtatttaccgggcagtcaaagatctattcctacatgagcccg
aacaaatgctctggaatgcgtttcccccttcaggaagagaactcagttacacatcacgaa
gtcaaatgccaggggaaaccattagccggaatctacaggaaacgagaagagaaaagaaat
gctgggaacgcagtacggagcgccatgaagtccgaggaacagaagatcaaagacgccagg
agaggtcccctggtaccttttccaaaccaaaaatctgaagcagcagaacctccaaaaact
ccaccctcatcttgtgattccaccaatgcagccattgccaagcaagccctgaaaaagccc
atcaagggcaaacaggcccctcgaaaaaaagctcaaggaaaaacgcaacagaatcgcaaa
cttacggatttctaccctgtccgaaggagctccaggaagagcaaagccgagctgcagtct
gaagaaaggaaaagaatagatgaattgattgaaagtgggaaggaagaaggaatgaagatt
gacctcatcgatggcaaaggcaggggtgtgattgccaccaagcagttctcccggggtgac
tttgtggtggaataccacggggacctcatcgagatcaccgacgccaagaaacgggaggct
ctgtacgcacaggacccttccacaggctgctacatgtactattttcagtatctgagcaaa
acctactgcgtggatgcaactagagagacaaatcgcctaggaagactgatcaatcacagc
aaatgtgggaactgccaaaccaaactgcacgacatcgacggcgtacctcacctcatcctc
atcgcctcccgcgacatcgcggctggggaggagctcctgtatgactatggggaccgcagc
aaggcttccattgaagctcacccgtggctgaagcattaa

DBGET integrated database retrieval system