KEGG   Pan troglodytes (chimpanzee): 107971148Help
Entry
107971148         CDS       T01005                                 

Gene name
SUV39H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107971148 (SUV39H1)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107971148 (SUV39H1)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107971148 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107971148 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 107971148
NCBI-ProteinID: XP_016802985
UniProt: H2QYK0
LinkDB All DBs
Position
X
AA seq 423 aa AA seqDB search
MVGMSRLRNDRLADPLTGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLC
DYKKIREQEYYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRH
LDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVG
EGITLNQVAVGCECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCG
YDCPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQI
YDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAF
FATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRK
YLF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggtggggatgagtcgcctgagaaatgacagactggctgacccactgacaggctgcagc
gtgtgttgcaagtcttcttggaatcagctgcaggacctgtgccgcctggccaagctctcc
tgccctgccctcggtatctctaagaggaacctctatgactttgaagtcgagtacctgtgc
gattacaagaagatccgcgaacaggaatattacctggtgaaatggcgtggatatccagac
tcagagagcacctgggagccacggcagaatctcaagtgtgtgcgtatcctcaagcagttc
cacaaggacttagaaagggagctgctccggcggcaccaccggtcaaagaccccccggcac
ctggacccaagcttggccaactacctggtgcagaaggccaagcagaggcgggcgctccgt
cgctgggagcaggagctcaatgccaagcgcagccatctgggacgcatcactgtagagaat
gaggtggacctggacggccctccgcgggccttcgtgtacatcaatgagtaccgtgttggt
gagggcatcaccctcaaccaggtggctgtgggctgcgagtgccaggactgtctgtgggca
cccactggaggctgctgcccgggggcgtcactgcacaagtttgcctacaatgaccagggc
caggtgcggcttcgagccgggctgcccatctacgagtgcaactcccgctgccgctgtggc
tatgactgcccaaatcgcgtggtacagaagggcatccgatatgacctctgcatcttccgc
acggatgatgggcgcggctggggcgtccgcaccctggagaagattcgcaagaacagcttc
gtcatggagtacgtgggagagatcattacctcagaggaggcagagcggcggggccagatc
tacgaccgtcagggcgccacctacctctttgacctggactacgtggaggacgtgtacacc
gtggatgccgcctactatggcaacatctcccactttgtcaaccacagttgtgaccccaac
ctgcaggtgtacaacgtcttcatagacaaccttgacgagcggctgccccgcatcgctttc
tttgccacaagaaccatccgggcaggcgaggagctcacctttgattacaacatgcaagtg
gaccccgtggacatggagagcacccgcatggactccaactttggcctggctgggctccct
ggctcccctaagaagcgggtccgtattgaatgcaagtgtgggactgagtcctgccgcaaa
tacctcttctag

DBGET integrated database retrieval system