KEGG   Pan troglodytes (chimpanzee): 107971434Help
Entry
107971434         CDS       T01005                                 

Gene name
ASH1L
Definition
(RefSeq) ASH1 like histone lysine methyltransferase
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107971434 (ASH1L)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107971434 (ASH1L)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107971434 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
1
AA seq 2509 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTVVSKREVELEKNTKEEEDLRKRNRERNIEA
GKDDGLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIHLHSQGENNPLSKKLSP
VHSEMADYINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
GTGTTAGLVSKDLIRKAGVGSVAGIIHKDLIKKPTISTAVGLVTKDPGKKPVFNAAVGLV
NKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLVSCPLAGLISKD
AINLKAEALLPTQEPLKASCSTNINNQESQELSESLKDSATSKTFEKNVVRQNKESILEK
FSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSYETSKHEKQPPVYCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVG
KNQFTSESTHLNVGHRSVGHSISIECKGIDKEVNDSKTTHIDIPRISSSLGKKPSLTSES
SIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLP
KLSKSTAPSLALLADSEKPSHKSFATHKLSSSMCVSSDLLSDIYKPKRGRPKSKEMPQLE
GPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMS
DLEMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHS
RQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSD
SGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
SYDKMKRQKRKRKKKYPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIF
RINFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYP
SYGMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQV
SMDTGSSRSVLESLKRYRFGKDAVGERYKHKEKHRCHMSCPHLSPSKSLINREEQWVHRE
PSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAVSQELLPIMLPIMISMDLT
PIPSPTASEAPDVTKRRSFEESACTLFLPSGSQPTSDKPSQRPSESTNCSPTRKRSSSES
TSSTVNGVPSRSPRLVASGDDSVDSLLQRMVQNEDQEPMEKSIDAVIATASAPPSSSPGR
SHSKDRTLGKPDSLLVPAVASDSCNNSISLLSEKLTSSCSPHHIKRSVVEAMQRQARKMC
NYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQAVVSMQAFQAAQ
FVNPELNRGEEGAALHLSPDTVTDVIEAVVQSVNLNPEHKKGLKRKGWLLEEQTRKKQKP
LPEEEEQENNKSFNEAPVEIPSPSETPAKPSEPESTLQPVLSLIPREKKPPRPPKKKYQK
AGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVGKYLRQKRIDFQLPYDI
LWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNR
MIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLG
EVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSV
NGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNGLTS
SKNSQPMATHKKSGRSKEKRKSKHKLKKRRGHLSEEPSENINTPTRLTPQLQMKPMSNRE
RNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLYTRWNGICRDDGNIKSDVFMTQF
SALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISYKEVLWA
NT seq 7530 nt NT seq  +upstreamnt  +downstreamnt
atggaccctagaaatactgctatgttaggattgggttctgattccgaaggtttttcaaga
aagagtccttctgccatcagtactggcacagtggtcagtaagagagaagtagagctagaa
aaaaacacaaaggaggaagaggaccttcgcaaacggaatcgagaaagaaacatcgaagct
gggaaagatgatggtttgactgatgcacagcaacagttttcagtgaaagaaacaaacttt
tcagagggaaatttaaaattgaaaattggcctccaggctaagagaactaaaaaacctcca
aagaacttggagaactatgtatgtcgacctgccataaaaacaactattaagcacccaagg
aaagcacttaaaagtggaaagatgacggatgaaaagaatgaacactgtccttcaaaacga
gacccttcaaagttgtacaagaaagcagatgatgttgcagccattgaatgccagtctgaa
gaagtcatccatcttcattcacagggagaaaacaatcctttgtctaagaagctgtctcca
gtacactcagaaatggcagattatattaatgcaacaccatctactcttcttggtagccgg
gatcctgatttaaaggacagagcattacttaatggaggaactagtgtaacagaaaagttg
gcacagctgattgctacctgtcctccttccaagtcttccaagacaaaaccgaagaagtta
ggaactggcactacggcaggattggttagcaaggatttgatcaggaaagcaggtgttggc
tctgtagctggaataatacataaggacttaataaaaaagccaaccatcagcacagcagtt
ggattggtaactaaagatcctgggaaaaagccagtgtttaatgcagcagtaggattggtc
aataaggactctgtgaaaaaactgggaactggcactacagcggtattcattaataaaaac
ttaggcaaaaagccaggaactatcactacagtaggactgctaagcaaagattcaggaaag
aagctaggaattggtattgttccaggtttagtgcataaagagtctggcaagaagttagga
cttggcactgtggttggactggttaataaagatttgggaaagaaattgggttctactgtt
ggcctagtggccaaggactgtgcaaagaagattgtagcaagttcagcaatgggattggtt
aataaggacattggaaagaaactagtgagttgtcctttggcaggtctgatcagtaaagat
gccataaaccttaaagccgaagcactgctccccactcaggaaccacttaaggcttcttgt
agtacaaacatcaataatcaggaaagtcaggaactttctgaatccctgaaagatagtgcc
accagcaaaacttttgaaaagaatgttgtacggcagaataaagaaagcatattggaaaag
ttctcagtacgaaaagaaatcattaatttggagaaagaaatgtttaatgaaggaacatgc
attcagcaagacagtttctcatccagtgaaaagggatcttatgaaacctcaaagcatgaa
aagcagcctcctgtatattgcacttctccggactttaaaatgggaggtgcttctgatgta
tctacggctaaatccccattcagtgcagtaggagaaagcaatctcccttccccatcacct
actgtatctgttaatcctttaaccagaagtccccctgaaacttcttcacagttggctcct
aatccgttacttttaagttctactacagaactaatcgaagaaatttctgaatctgttgga
aagaaccagtttacttctgaaagtacccacttgaacgttggtcataggtcagtgggtcat
agtataagtattgaatgtaaagggattgataaagaggtaaatgattcaaaaactacccat
atagatattccaagaataagctcttcccttggaaaaaagccaagtttgacttctgaatcc
agcattcatactattactccttcagttgttaacttcactagtttatttagtaataagcct
tttttaaaactgggtgcagtatctgcatcagacaaacactgccaagttgctgaaagccta
agtactagtttgcagtccaaaccattaaaaaaaagaaaaggaagaaaacctcggtggact
aaagtggtggcaagaagcacatgccggtctccaaaagggctagaattagaaagatcagag
ctttttaaaaacgtttcatgtagctcactatcaaatagtaattctgagccagccaagttt
atgaaaaacattggacccccttcatttgtagatcatgacttccttaaacgccgattgcca
aagttgagcaaatccacagctccatctcttgctctcttagctgatagtgaaaaaccatct
cataagtcttttgctactcacaaactatcctccagtatgtgtgtctctagtgaccttttg
tctgatatttataagcccaaaagaggaaggcctaaatctaaggagatgcctcaactggaa
gggccacctaaaaggactttaaaaatccctgcttctaaagtgttttctttacagtctaag
gaagaacaagaacccccaattttacagccagaaattgaaatcccttccttcaaacaaggt
ctgtctgtgtctccttttccaaaaaagagaggcaggcctaagaggcaaatgaggtcacca
gtcaagatgaagccacctgtactgtcagtggctccatttgttgccactgaaagtccaagc
aagctagaatctgaaagtgacaaccatagaagtagcagtgatttctttgagagcgaggat
caacttcaggatccagatgacctagatgacagtcataggccaagtgtctgtagtatgagt
gaccttgagatggaaccagataaaaaaattaccaagagaaacaatggacaattaatgaaa
acaattatccgcaaaataaataaaatgaagactttaaagagaaagaaactgttgaatcag
attctttcaagttctgtagaatcaagtaataaagggaaagtgcaatccaaactccataat
acggtatcaagtcttgctgccacatttggctctaaattgggccaacagataaatgtcagc
aagaaaggaaccatttatataggaaagagaagaggtcgcaaaccaaaaactgtcttaaat
ggtattctttctggtagtcctactagccttgctgttcttgagcaaacagctcaacaggca
gctgggtcagcattaggacagattcttcccccattactgccttcatctgctagtagttct
gagattcttccatcacctatttgctctcagtcttctgggactagtggaggtcagagccct
gtaagtagtgatgcaggttttgttgaacccagttcagtgccatatttgcatttacactcc
agacagggcagtatgattcagactcttgcaatgaagaaggcctcaaaggggaggaggcgg
ttatctcctcctactttgttgccaaattctccttcgcacttgagtgaactcacatctcta
aaagaagctactccttccccaatcagtgagtctcatagtgatgagaccattcccagtgat
agtggaattggaacagataataacagcacatcagacagggcagagaaattttgtgggcaa
aaaaagaggaggcattcttttgagcatgtttctctgattccccctgaaacctctacagtg
ctaagcagtcttaaagaaaaacataaacacaaatgtaagcgcaggaatcatgattacctc
agctatgacaagatgaaaaggcagaaacgaaaacggaaaaagaaatatccccagcttcga
aatagacaggatccagactttattgcagagctggaggaactaataagtcgcctaagtgaa
attcggatcactcatcgaagtcatcattttatcccccgagatcttctgccaactatcttt
cgaatcaactttaatagtttctatacacatccttctttccccttagaccctttgcactac
attcgaaaacctgacttaaaaaagaaaagagggagaccccctaagatgagggaggcaatg
gctgaaatgccttttatgcacagccttagttttcctctttctagtactggattctatcca
tcttatggtatgccttactctccttcaccccttacagctgctcccataggattaggttac
tatggaaggtatcctcccactctttatccacctcctccatctccttctttcaccacgcca
cttccacctccttcctatatgcatgctggtcatttacttctcaatcctgccaaataccat
aagaaaaagcataagctacttcgacaggaggcctttcttacaaccagcaggactcccctc
ctttccatgagtacctaccccagtgttcctcctgagatggcctatggttggatggttgag
cacaaacacaggcaccgtcacaaacacagagaacaccgttcttctgaacaaccccaggtt
tctatggacactggctcttcccgatctgtcctggaatctttgaagcgctatagatttgga
aaggatgctgttggagagcgatataagcataaggaaaagcaccgttgtcacatgtcctgc
cctcatctctctccttcaaaaagcttaataaacagagaggaacagtgggtccaccgagag
ccttcagaatctagtccattggccttgggattgcagacacctttacagattgactgttca
gaaagttctccaagcttatcccttggaggattcactcccaactctgagccagccagcagt
gatgaacatacaaaccttttcacaagtgcaataggcagctgcagagtttcaaaccctaac
tccagtggccggaagaaattaactgacagccctggactcttttctgcacaggacacttca
ctaaatcggcttcacagaaaggagtcactgccttctaacgaaagggcagtacagactttg
gcagtttctcaggaattgctgccaataatgctgccaataatgatctccatggatctgacc
cccattccatctcccactgcctctgaagctccagatgtcaccaaaagaaggagctttgaa
gaaagtgcttgtaccctctttttaccctcaggctcccagccaacctctgataaaccctcc
cagcggccatcagagagcacaaattgtagccctacccggaaaaggtcttcatctgagagt
acttcttcaacagtaaacggagttccctctcgaagtccaagattagttgcttctggggat
gactctgtggatagtctgctgcagcggatggtacaaaatgaggaccaagagcccatggag
aaaagtattgatgctgtgattgcaactgcctctgcaccaccttcttccagtccaggccgt
agccacagcaaggaccgaaccctgggaaaaccagacagccttttagtgcctgcagtcgca
agtgactcttgcaataatagcatctcactcctatctgaaaagttgacaagcagctgttcc
ccgcatcatatcaagagaagtgtagtggaagctatgcaacgccaagctcggaaaatgtgc
aattacgacaaaatcttggccacaaagaaaaacctagaccatgtcaataaaatcttaaaa
gccaaaaaacttcaaaggcaggccaggacagggaataactttgtgaaacgtaggccaggt
cgacctcggaaatgtccccttcaggctgtcgtatcaatgcaagcattccaggctgctcag
tttgtcaacccagaattgaacagaggcgaggaaggagcagcactgcacctcagtcctgac
acagttacagatgtaattgaggctgttgttcagagtgtaaatctgaacccagaacataaa
aaggggttgaagagaaaaggttggctattggaagaacagaccagaaaaaagcagaagcca
ttaccagaggaagaagagcaagagaataataaaagctttaatgaagcaccagttgagatt
cccagtccttctgaaaccccagctaaaccttctgaacctgaaagtaccttgcagcctgtg
ctttctctcatcccaagggaaaagaagcccccacgtcccccaaagaagaagtatcagaaa
gcagggctgtattctgacgtttacaaaactacagacccaaagagtcgattgatccaatta
aagaaagagaagctggagtatactccaggagagcatgaatatggattatttccagcgccc
attcatgttggaaagtatctaagacaaaagagaattgacttccagcttccttatgatatc
ctttggcagtggaaacacaatcagctatacaaaaagccagatgtcccactatataagaaa
attcgttcaaatgtttacgttgatgtcaaacccctttctggttacgaagctaccacctgt
aactgtaagaagccagatgatgacaccaggaagggctgtgttgatgactgcctcaataga
atgatctttgctgagtgttcccccaacacttgcccatgtggcgagcaatgctgtaaccag
aggatacagaggcatgaatgggtgcaatgtctagaacgatttcgagctgaggaaaaaggc
tggggaatcagaaccaaagagcccctaaaagctgggcagttcatcattgaatacctaggg
gaagtcgtcagcgaacaggagttcaggaacaggatgattgagcagtatcataatcacagt
gaccactactgcctgaacctggatagtgggatggtgattgacagttaccgcatgggaaat
gaggcccgattcatcaaccatagctgtgacccaaattgtgaaatgcagaaatggtctgtt
aatggagtataccggattggactctatgctcttaaagacatgccagctgggactgaactc
acttatgattataactttcattccttcaatgtggaaaaacagcaactttgtaagtgtggc
tttgagaaatgtcgaggaatcatcggaggcaagagtcagcgtgtgaatggactcaccagc
agcaaaaacagccagcccatggccacacacaaaaaatctggacggtcaaaagagaagaga
aagtctaagcacaagctgaagaaaaggagaggccatctctctgaggaacccagtgaaaat
atcaacaccccaactagattgaccccccaattacagatgaagccaatgtccaatcgtgaa
aggaactttgtgttaaagcatcatgtattcttggtccgaaactgggagaagattcgtcaa
aaacaggaggaagtaaagcacaccagtgataatattcactcagcatcattatatacccgt
tggaatgggatctgccgagatgatgggaatatcaagtctgatgtcttcatgacccagttc
tctgccctgcagacagctcgatctgttcgaacaagacggttggcagctgcagaggaaaat
attgaagtggctcgggcagcccgcctagcccagatcttcaaagaaatttgtgatggtatc
atctcttataaagaagtactatgggcgtaa

DBGET integrated database retrieval system