KEGG   Pan troglodytes (chimpanzee): 452653Help
Entry
452653            CDS       T01005                                 

Gene name
LIG4
Definition
(RefSeq) DNA ligase 4 isoform X3
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    452653 (LIG4)
Enzymes [BR:ptr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     452653 (LIG4)
DNA repair and recombination proteins [BR:ptr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     452653 (LIG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT DNA_ligase_IV DNA_ligase_A_C BRCT_2 RNA_ligase APG17 mRNA_cap_enzyme LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 452653
NCBI-ProteinID: XP_509726
Ensembl: ENSPTRG00000006025
UniProt: H2R1R7
LinkDB All DBs
Position
13
AA seq 911 aa AA seqDB search
MAASQTSQTVASHVPFADLCSTLERIQKSKGRAEKIRHFREFLDSWRKFHDALHKNHKDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRDGKDALKLLNYRTPTGTHG
DAGDFAMIAYFVLKPRCLQKGSLTIQQVNDLLDSIASNNSAKRKDLIKKSLLQLITQSSA
LEQKWLIRMIIKDLKLGVSQQTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISI
TLFSAFKPMLAAIANIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYKYFSRNGYNYTD
QFGASSTEGSLTPFIHNAFKADIQICILDGEMMAYNPNTQTFMQKGTKFDIKRMVEDSDL
QTCYCVFDVLMVNNKKLGHETLRKRYEILSSIFTPIPGRIEIVQKTQAHTKNEVIDALNE
AIDKREEGIMVKQPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMM
SHFLCAVAEKPPPGEKPSVFHTLSRVGSGCTMKELYDLGLKLAKYWKPFHRKAPPSSILC
GTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGCTLRFPRIEKIRDDKEWHECMTLDDLE
QLRGKASGKLASKHLYIGGDDEPQEKRRKAAPKMKKVIGIIEHLKAPNLTNVNKISNIFE
DVEFCVMSGTDSQPKPDLENRIAEFGGYIVQNPGPDTYCVIAGSKNIRVKNIISSNKHDV
VKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSG
IKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYAVINDLSTKNEGTRLAI
KALELRFHGAKVVSCLAEGVSHVIIGEDHSRVADFKAFRRTFKRKFKILKESWVTDSIDK
CELQEENQYLI
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcacaaacttcacaaactgttgcatctcacgttccttttgcagatttgtgt
tcaactttagaacgaatacagaaaagtaaaggacgtgcagaaaaaatcagacacttcagg
gaatttttagattcttggagaaaatttcatgatgctcttcataagaaccacaaagatgtc
acagactctttttatccagcaatgagactaattcttcctcagctagaaagagagagaatg
gcctatggaattaaagaaactatgcttgctaagctttatattgagttgcttaatttacct
agagacggaaaagatgccctcaaacttttaaactacagaacacccactggaactcatgga
gatgctggagactttgcaatgattgcatattttgtgttgaagccaagatgtttacagaaa
ggaagtttaaccatacagcaagtaaacgaccttttagactcaattgccagcaataattct
gctaaaagaaaagacctaataaaaaagagccttcttcaacttataactcagagttcagca
cttgagcaaaagtggcttatacggatgatcataaaggatttaaagcttggtgttagtcag
caaactatcttttctgtttttcataatgatgctgctgagttgcataatgtcactacggat
ctggaaaaagtctgtaggcaactgcatgatccttctgtaggactcagtgatatttctatc
actttattttctgcctttaaaccaatgctagctgctattgcaaatattgagcacattgag
aaggatatgaaacatcagagtttctacatagaaaccaagctagatggcgaacgtatgcaa
atgcacaaagatggagatgtatataaatacttctctcgaaatggatataactacactgat
cagtttggtgcttcttctaccgaaggttctcttaccccattcattcataatgcattcaaa
gcagatatacaaatctgtattcttgatggtgagatgatggcctataatcctaatacacaa
actttcatgcaaaagggaactaagtttgatattaaaagaatggtagaggattctgatctg
caaacttgttattgtgtttttgatgtattgatggttaataataaaaagctagggcatgag
actctgagaaagaggtatgagattcttagtagtatttttacaccaattccaggtagaata
gaaatagtgcagaaaacacaagctcatactaagaatgaagtaattgatgcattgaatgaa
gcaatagataaaagagaagagggaattatggtaaaacaacctctatccatctacaagcca
gacaaaagaggtgaagggtggttaaaaattaaaccagagtatgtcagtggactaatggat
gaattggacattttaatcgttggaggatattgggggaaaggatcacggggtggaatgatg
tctcattttctgtgtgcagtagcagagaagccccctcctggtgagaagccgtctgtgttt
catactctctctcgtgttggctctggctgcaccatgaaagaactgtatgatctgggtttg
aaattggccaagtattggaagccgtttcatagaaaagctccaccaagcagcattttatgt
ggaacagagaagccagaagtgtacattgaaccttgtaattctgtcattgttcagattaag
gcagcagagatcgtacccagtgatatgtataaaactggctgcaccttgcgttttccacga
attgaaaagataagagatgacaaggagtggcatgagtgcatgaccctggacgacctagaa
caacttagggggaaggcatctggtaagctcgcatctaaacacctttatataggtggtgat
gatgaaccacaagaaaaaaggcggaaagctgccccaaagatgaagaaagttattggaatt
attgagcacttaaaagcacctaaccttactaacgttaacaaaatttctaatatatttgaa
gatgtagagttttgtgttatgagtggaacagatagccagccaaagcctgacctggagaac
agaattgcagaatttggtggttatatagtacaaaatccaggcccagacacgtactgtgta
attgcagggtctaagaacatcagagtgaaaaacataatttcgtcaaataaacatgatgtc
gtcaagcctgcatggcttttagaatgttttaagaccaaaagctttgtaccatggcagcct
cgctttatgattcatatgtgcccatcaaccaaagaacattttgcccgtgaatatgattgc
tatggtgatagttatttcattgatacagacttgaaccaactgaaggaagtattctcagga
attaaaaattctaacgagcagactcctgaagaaatggcttctctgattgctgatttagaa
tatcggtattcctgggattgctctcctctcagtatgtttcgacgccacaccgtttatttg
gactcgtatgctgttattaatgacctgagtaccaaaaatgaggggacaaggttagctatt
aaagccttggagcttcggtttcatggagcaaaagtagtgtcttgtttagctgagggagtg
tctcatgtaatcattggggaagatcatagtcgtgttgcagattttaaagcttttagaaga
acttttaagagaaagtttaaaatcctaaaagaaagttgggtaactgattcaatagacaag
tgtgaattacaagaagaaaaccagtatttgatttaa

DBGET integrated database retrieval system