KEGG   Pan troglodytes (chimpanzee): 452719Help
Entry
452719            CDS       T01005                                 

Gene name
SETDB2
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2 isoform X1
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    452719 (SETDB2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     452719 (SETDB2)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     452719 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    452719 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD MBD_C
Motif
Other DBs
NCBI-GeneID: 452719
NCBI-ProteinID: XP_001153947
Ensembl: ENSPTRG00000005873
UniProt: H2R1P1
LinkDB All DBs
Position
13
AA seq 719 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
IINSSTSIKGASQKEVNAQSSDHMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTENKE
ILSLEDKVVDFREKDSSSNLSYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKT
NSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQKEV
VSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAYNLTNFSSMFTDSCDCSEGCI
DITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRV
VQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSYGIDENGRDEN
TMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTEKCPPKFSNNPKELTMETKYDNI
SRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDS
SSNHVDEFEDNLLIESDVIDITKYREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGR
STACQRQQVFCDEELLSETKNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLSV
QNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggcgatgcaaaaactttctggatggagctagaagatgatggaaaa
gtggacttcatttttgaacaagtacaaaatgtgctgcagtcactgaaacaaaagatcaaa
gatgggtctgccaccaataaagaatacatccaagcaatgattctagtgaatgaagcaact
ataattaacagttcaacatcaataaagggagcatcacagaaagaagtgaatgcccaaagc
agtgatcatatgcctgtgactcagaaggaacaggaaaacaaatccaatgcatttccctct
acatcatgtgaaaactcctttccagaagactgtacatttctaacaacagaaaataaggaa
attctctctcttgaagataaagttgtagactttagagaaaaagactcatcttcaaattta
tcttatcaaagtcatgactgctctggtgcttgtctgatgaaaatgccactgaacttgaag
ggagaaaaccctctgcagctgccaatcaaatgtcacttccaaagacgacatgcaaagaca
aactctcattcttcagcactccacgtgagttataaaaccccttgtggaaggagtctacga
aacgtggaggaagtttttcgttacctgcttgagacagagtgtaactttttatttacagat
aacttttctttcaatacctatgttcagttggctcggaattacccaaagcaaaaagaagtt
gtttctgatgtggatattagcaatggagtggaatcagtgcccatttctttctgtaatgaa
attgacagtagaaagctcccacagtttaagtacagaaagactgtgtggcctcgagcatat
aatctaaccaacttttccagcatgtttactgattcctgtgactgctctgagggctgcata
gacataacaaaatgtgcatgtcttcaactgacagcaaggaatgccaaaacttcccccttg
tcaagtgacaaaataaccactggatataaatataaaagactacagagacagattcctact
ggcatttatgaatgcagccttttgtgcaaatgtaatcgacaattgtgtcaaaaccgagtt
gtccaacatggtcctcaagtgaggttacaggtgttcaaaactgagcagaagggatggggt
gtacgctgtctagatgacattgacagagggacatttgtttgcatttattcaggaagatta
ctaagcagagctaacactgaaaaatcttatggtattgatgaaaatgggagagatgagaat
actatgaaaaatatattttcaaaaaagaggaaattagaagttgcatgttcagattgtgaa
gttgaagttctcccattaggattggaaacacatcctagaactgctaaaactgagaaatgt
ccaccaaagttcagtaataatcccaaggagcttactatggaaacgaaatatgataatatt
tcaagaattcaatatcattcagttattagagatcctgaatccaagacagccatttttcaa
cacaatgggaaaaaaatggaatttgtttcctcggagtctgtcactccagaagataatgat
ggatttaaaccaccccgagagcatctgaactctaaaaccaagggagcacaaaaggactca
agttcaaaccatgttgatgagtttgaagataatctgctgattgaatcagatgtgatagat
ataactaaatacagagaagaaactccaccaaggagcagatgtaaccaggcgaccacattg
gataatcagaatattaaaaaggcaattgaggttcaaattcagaaaccccaagagggacga
tctacagcatgtcaaagacagcaggtcttttgtgatgaagagttgctaagtgaaaccaag
aatacttcatctgattctctaacaaagttcaataaagggaatgtgtttttattggatgcc
acaaaagaaggaaatgtcggccgcttccttaatcatagttgttgcccaaatctctcggta
cagaatgtttttgtagaaacacacaacaggaattttccattggtggcattcttcactaac
aggtatgtgaaagcaagaacagagctaacatgggattatggctatgaagctgggactgtg
cctgagaaggaaatcttctgccaatgtggggttaataaatgtagaaaaaaaatattataa

DBGET integrated database retrieval system