KEGG   Pan troglodytes (chimpanzee): 452719Help
Entry
452719            CDS       T01005                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    452719 (SETDB2)
Enzymes [BR:ptr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     452719 (SETDB2)
Chromosome [BR:ptr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     452719 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    452719 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
13
AA seq 719 aa AA seqDB search
MGEKNGDAKTFWMELEDDGKVDFIFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVNEAT
IINSSTSIKGASQKEVNAQSSDHMPVTQKEQENKSNAFPSTSCENSFPEDCTFLTTENKE
ILSLEDKVVDFREKDSSSNLSYQSHDCSGACLMKMPLNLKGENPLQLPIKCHFQRRHAKT
NSHSSALHVSYKTPCGRSLRNVEEVFRYLLETECNFLFTDNFSFNTYVQLARNYPKQKEV
VSDVDISNGVESVPISFCNEIDSRKLPQFKYRKTVWPRAYNLTNFSSMFTDSCDCSEGCI
DITKCACLQLTARNAKTSPLSSDKITTGYKYKRLQRQIPTGIYECSLLCKCNRQLCQNRV
VQHGPQVRLQVFKTEQKGWGVRCLDDIDRGTFVCIYSGRLLSRANTEKSYGIDENGRDEN
TMKNIFSKKRKLEVACSDCEVEVLPLGLETHPRTAKTEKCPPKFSNNPKELTMETKYDNI
SRIQYHSVIRDPESKTAIFQHNGKKMEFVSSESVTPEDNDGFKPPREHLNSKTKGAQKDS
SSNHVDEFEDNLLIESDVIDITKYREETPPRSRCNQATTLDNQNIKKAIEVQIQKPQEGR
STACQRQQVFCDEELLSETKNTSSDSLTKFNKGNVFLLDATKEGNVGRFLNHSCCPNLSV
QNVFVETHNRNFPLVAFFTNRYVKARTELTWDYGYEAGTVPEKEIFCQCGVNKCRKKIL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggcgatgcaaaaactttctggatggagctagaagatgatggaaaa
gtggacttcatttttgaacaagtacaaaatgtgctgcagtcactgaaacaaaagatcaaa
gatgggtctgccaccaataaagaatacatccaagcaatgattctagtgaatgaagcaact
ataattaacagttcaacatcaataaagggagcatcacagaaagaagtgaatgcccaaagc
agtgatcatatgcctgtgactcagaaggaacaggaaaacaaatccaatgcatttccctct
acatcatgtgaaaactcctttccagaagactgtacatttctaacaacagaaaataaggaa
attctctctcttgaagataaagttgtagactttagagaaaaagactcatcttcaaattta
tcttatcaaagtcatgactgctctggtgcttgtctgatgaaaatgccactgaacttgaag
ggagaaaaccctctgcagctgccaatcaaatgtcacttccaaagacgacatgcaaagaca
aactctcattcttcagcactccacgtgagttataaaaccccttgtggaaggagtctacga
aacgtggaggaagtttttcgttacctgcttgagacagagtgtaactttttatttacagat
aacttttctttcaatacctatgttcagttggctcggaattacccaaagcaaaaagaagtt
gtttctgatgtggatattagcaatggagtggaatcagtgcccatttctttctgtaatgaa
attgacagtagaaagctcccacagtttaagtacagaaagactgtgtggcctcgagcatat
aatctaaccaacttttccagcatgtttactgattcctgtgactgctctgagggctgcata
gacataacaaaatgtgcatgtcttcaactgacagcaaggaatgccaaaacttcccccttg
tcaagtgacaaaataaccactggatataaatataaaagactacagagacagattcctact
ggcatttatgaatgcagccttttgtgcaaatgtaatcgacaattgtgtcaaaaccgagtt
gtccaacatggtcctcaagtgaggttacaggtgttcaaaactgagcagaagggatggggt
gtacgctgtctagatgacattgacagagggacatttgtttgcatttattcaggaagatta
ctaagcagagctaacactgaaaaatcttatggtattgatgaaaatgggagagatgagaat
actatgaaaaatatattttcaaaaaagaggaaattagaagttgcatgttcagattgtgaa
gttgaagttctcccattaggattggaaacacatcctagaactgctaaaactgagaaatgt
ccaccaaagttcagtaataatcccaaggagcttactatggaaacgaaatatgataatatt
tcaagaattcaatatcattcagttattagagatcctgaatccaagacagccatttttcaa
cacaatgggaaaaaaatggaatttgtttcctcggagtctgtcactccagaagataatgat
ggatttaaaccaccccgagagcatctgaactctaaaaccaagggagcacaaaaggactca
agttcaaaccatgttgatgagtttgaagataatctgctgattgaatcagatgtgatagat
ataactaaatatagagaagaaactccaccaaggagcagatgtaaccaggcgaccacattg
gataatcagaatattaaaaaggcaattgaggttcaaattcagaaaccccaagagggacga
tctacagcatgtcaaagacagcaggtcttttgtgatgaagagttgctaagtgaaaccaag
aatacttcatctgattctctaacaaagttcaataaagggaatgtgtttttattggatgcc
acaaaagaaggaaatgtcggccgcttccttaatcatagttgttgcccaaatctctcggta
cagaatgtttttgtagaaacacacaacaggaattttccattggtggcattcttcactaac
aggtatgtgaaagcaagaacagagctaacatgggattatggctatgaagctgggactgtg
cctgagaaggaaatcttctgccaatgtggggttaataaatgtagaaaaaaaatattataa

DBGET integrated database retrieval system