KEGG   Pan troglodytes (chimpanzee): 461740Help
Entry
461740            CDS       T01005                                 

Gene name
PCSK1
Definition
(RefSeq) neuroendocrine convertase 1 isoform X1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     461740 (PCSK1)
Peptidases [BR:ptr01002]
 Serine Peptidases
  Family S8: subtilisin family
   461740 (PCSK1)
Chaperones and folding catalysts [BR:ptr03110]
 Intramolecular chaperones
  Subtilisin family
   461740 (PCSK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein Proho_convert S8_pro-domain OmpA_membrane Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 461740
NCBI-ProteinID: XP_001134900
Ensembl: ENSPTRG00000017091
UniProt: H2QR92
LinkDB All DBs
Position
5
AA seq 753 aa AA seqDB search
MERRAWSLQCTAFVLFCAWCALNSAKAKRQFVNEWAAEIPGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSAFHITKRLSDDDRVIWAEQQYEKERSKRSALRDSALNL
FNDPMWNQQWYLQDTRMTAALPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRITDMSGRIQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVDPGEEQPTQENPKENTLVSKSPSSSSVGGRRDELEE
GAPSEAMLRLLQSAFSKNSPPKQSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSL
YNDYVDVFYNTKPYKHRDDRLLQALVDILNEEN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaagagcctggagtctgcagtgcactgctttcgtcctgttttgcgcttggtgt
gcactgaacagtgcaaaagcgaaaaggcaatttgtcaatgaatgggcagcggagatcccc
gggggcccggaagcagcctcggccatcgccgaggagctgggctatgaccttttgggtcag
attggttcacttgaaaatcactacttattcaaacataaaaaccaccccagaaggtctcga
aggagtgcctttcatatcactaagagattatctgatgatgatcgtgtgatatgggctgaa
caacagtatgaaaaagaaagaagtaaacgttcagctctaagggactcagcactaaatctc
ttcaatgatcccatgtggaatcagcaatggtacttgcaagataccaggatgacggcagcc
ctgcccaagctggaccttcatgtgatacctgtttggcaaaaaggcattacgggcaaagga
gttgttatcaccgtactggatgatggtttggagtggaatcacacggacatttatgccaac
tatgatccagaggctagctatgattttaatgataatgaccatgatccatttccccgatac
gatcccacaaacgagaataaacacgggaccagatgtgcaggagaaattgccatgcaagca
aataatcacaaatgcggggttggagttgcatacaattccaaagttggaggcataagaatg
ctggatggcattgtgacggatgctattgaggccagttcaattggattcaatcctggacac
gtggatatttacagtgcaagctggggccccaatgatgatgggaaaactgtggaggggcct
ggccggctagcccagaaggcttttgaatatggtgtcaaacaggggagacaggggaagggg
tccatcttcgtctgggcttcgggaaacggggggcgtcagggagataattgtgactgtgat
ggctacacagacagcatctacaccatctccatcagcagtgcctcccagcaaggcctatcc
ccctggtacgctgagaagtgctcctccacactggccacctcttacagcagcggagattac
accgaccagagaatcacgagcgctgacctgcacaatgactgcacggagacgcacacaggc
acctcggcctctgcacctctggctgctggcatcttcgctctggccctggaagcaaaccca
aatctcacctggcgagatatgcagcacctggttgtctggacctctgagtatgacccgctg
gccaataaccctggatggaaaaagaatggagcaggcttgatggtgaatagtcgatttgga
tttggcttgctaaatgccaaagctctggtggatttagctgaccccaggacctggaggagt
gtgcctgagaagaaagagtgtgttgtaaaggacaatgactttgagcccagagccctgaaa
gctaatggagaagttatcattgaaattccaacaagagcttgtgaaggacaagaaaatgct
atcaagtccctggagcatgtacaatttgaagcaacaattgaatattcccgaagaggagac
cttcatgtcacacttacttctgctgctggaactagcactgtgctcttggctgaaagagaa
cgggatacatctcctaatggctttaagaattgggacttcatgtctgttcacacatgggga
gagaaccctataggtacttggactttgagaattacagacatgtctggaagaattcaaaat
gaaggaagaattgtgaactggaagctgattttgcacgggacctcttctcagccagagcat
atgaagcagcctcgtgtgtacacgtcctacaacactgttcagaatgacagaagaggggtg
gagaagatggtggatccaggggaggagcagcccacacaagagaaccctaaggagaacacc
ctggtgtccaaaagccccagcagcagcagcgtagggggccggagggatgagttggaggag
ggagccccttctgaggccatgctgcgactcctgcaaagtgctttcagtaaaaactcaccg
ccaaagcaatcaccaaagaaatccccaagtgcaaagctcaacatcccttatgaaaacttc
tacgaagccctggaaaagctgaacaaaccttcccagcttaaagactctgaagacagtctg
tataatgactatgttgatgttttttataacactaaaccttacaagcacagagacgaccgg
ctgcttcaagctctggtggacattctgaatgaggaaaattaa

DBGET integrated database retrieval system