KEGG   Pseudomonas trivialis: AA957_22885Help
Entry
AA957_22885       CDS       T04006                                 

Definition
(GenBank) peptide synthase
Organism
ptv  Pseudomonas trivialis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5046893..5059774
Genome map
AA seq 4293 aa AA seqDB search
MMDAFELPQTLVQSLQRRAAQTPDQVALRFLAESAEHSVVLSYRDLDLRARTIAAALQAN
ADLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESTRRHHQERLLSIISDAEPRLL
LTIASLADGLAQIENAPMVLSVDTLGSTDTWIAPDLHPDDIAFLQYTSGSTALPKGVQVS
HGNLVANEVLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAYFL
GRPLRWLEAISEYGGTISGGPDFAYRLCSERVSESALERLDLSQWRVAYSGSEPIRLDTL
ERFAEKFAACGFTPNNFFASYGLAEATLFVAGGIRGQGIPALRVDEQALAANRAEPGQGS
AIMSCGTSQPEHAVLIADPHTLTELAENNVGELWATGPSIAHGYWRNPEATAKTFVQHAG
RTWLRTGDLGFIRSGEVYITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAFAV
NDQGLEGIGIAAEISRSVQKILPPEALIKAIRQAVAEAYQEAPSVVVLLNPGALPKTSSG
KVQRAACALRYVDGSLDRYAQFPDLHVQVSDAALGCELQNQIAAIWCEQLHVATVAADDH
FFLLGGNSITATQVVARLRETLGLELNLRMLFEAPTLEGFAAYVAQLQQDGGVAQGAIQP
LSRQEDLPQSLAQNRLWITWQLDPHSSAYTIPGALRLRGELDEDAVRLSFQHLVQRHEAL
RTRFYERDGQAFQRVEAKADFELQVIDLSDLPAAERETRAQQIREDEARTQFDLEKGPLL
WVTLVRLDDEDHQLLVTLHHIIADGWSLNILIDEFSRLYAAATQGQTLELPPLALQYADY
GSWQRQWLAEGEGQRQLAYWKAQLGEEHPTLSLATDHPRSAQQRNSASRHTVRLGVHLSE
AIRQTAQAHQSTPFMLLLAAFQSLLYRYSGQRDIRIGVPNANRPRQETQGLVGFFINTQV
MRAELDGRLPFNELLAATRETAMAAQAHQDLPFEQLLEAFPQAREQGLFQVMFNHQQRDL
SALRRLPGMLADELPWHSRDAKFDLQLHSEEDRNGRLSLSFDYADELFDSATIQRLAEHF
INLLQAACDQPQQAIGDLILMQADEQQAWSEAPCAPAQQWLPELLNRHTSDNTALVWQGG
SLTFAQLHTEANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIIKAGGAYVPLDPDY
PAERLAYMLEDSGVHLLLTQTALLDHVPVACGVCVIAMDSLHLDSWPTQPPGLHLHGDNL
AYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYQLNSTDVLMQKAPISFDVSVWECFWP
LITGCRLVLAGPGEHRDPHRIAQLVQEHGVTTLHFVPPLLQLFIDEPLVAKCTSLRRLFS
GGEALPAELRNRVLAQLPAVQLHNRYGPTETAINVTHWHCRAEDGERSPIGRPLGNVICR
VLDDQLYPVPLGVPGELCIGGIGLARGYLGRAGLTAERFVADHLGTRLYRTGDRARWSAE
GVLEYLGRLDQQVKLRGFRVEPEEIEARMLALDGIAQAVVLVRDAQLIGYYTAHGELDEQ
QVKTALAAELPEYMVPALLMRLDAMPLSPSGKLDRRALPEPVWQTREHIEPESPLQQQIA
AIWREVLGLPKIGLRDDFFALGGHSLLATQIISRTRQACDVELPLRTLFEASELGAFAEQ
VGLIQASGQRNQQTAIAKVDRSQPVPLSYSQQRMWFLWQMEPDSPAYNVGGMARLRGVLD
VGRFEAALQALIMRHETLRTTFPSVDGVAFQQVSSQTSLRMDWQDFSGLNETERQQRLQQ
LADHEAHTPFNLETGPLLRACLVKAAEREHYLVLTLHHIVTEGWAMDIFARELSALYEAF
IDERESPLAPLPVQYLDYSVWQRQWLESGERQRQLDYWTTQLGSEHPLLELPGDRPRPPV
QSHQGELYRFDLSDDLAARVRAFNAERGLTLFMTMTATLAVLLYRYSGQTDLRIGAPVAN
RIRPESEGLIGAFLNTQVLRCQLNGQMNVAELFEHVRHTVIEGQSHQDLPFDHLVDALQP
PRSAAYNPLFQVMCNVQRWEFQQSRQLAGMTVEYLANDARATKFDLNLEVTDLDHRLGCC
LTYSTDLFDEPRIARMAEHWRNLLEALIANPQQRLSELPLLTAAEQRALQDSLGAEAGEH
RLDQCIHQLFSQQAAARGDAPALTFAGVTLSYRELDACANRLAWMLRERGVGPQVRVGLA
LPRSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAAMFTALGALPA
TVACWCLEDDAPLLARYPSDALPFISLPQHQAYLIYTSGSTGKPKGVVVSHGEIAMHCAA
VIERFGMRADDCELHFYSINFDAATERLLVPLLSGAQVVLRAQGQWDAEEICALIRTHRI
NILGFTPSYGSQLAQWLATQQQTLPVRMCITGGEALTGEHLQRIRGAFQPEVFFNAYGPT
ETVVMPLASLAPEQLEEGAASVPIGSIIGDRVAYILDADLALVPQGATGELYVGGAGLAQ
GYHQRPGMTAERFVADPFATHGGRLYRTGDLVRQRADGLVEYLGRIDHQVKIRGFRIELG
EIETRLLEHEAVREAVVLALDSPSGKQLVAYLVSDADHSALRDALKAHLKAQLPDYMVPT
HLIVLDSMPLTANGKLDRRALPQPDPDANRQQYVAPRNELESTLAAIWCAVLNVQQVGLD
DNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVQTLAAVATRSEQVTAEQGVLTG
SSGLTPIQHWFFDTEIPNRQHWNQALVLKPLQLLDPHRLEQALLAVLEHHDALRLSFTQR
DAQWHAEHLAVPQGGVLMQAQVRDMHHSTALFTETQRSLDLAHGPLLRALLVDGPEGQQR
LLIAIHHLVVDGVSWRVLLEDLQNVYRQLSDGQSVSLPAKTSALRDWAARLQAYAGSESL
REELSLWQHQLAGPQAELPVARPQGSLRNRDADTVSVRLDVEHTRQLLQQAPSAYRTQVN
DLLLTALARVLCRWSGHESTLIQLEGHGRETLFDEIDLTRSVGWFTSAYPLRLTPRVGQG
DSIKAIKEQLRAVPHKGLGYGVLRYLADDLCKQTMAALPSAQITFNYLGQFDQSFGDDAL
FHPLDESAGLAHDPDAPLPNELSVDSQVYGGELVLRWTFSRERFDQQTVCELADAYLAEL
QSLVAHCLEGTAGGLTPSDFPLAQLTQSQLDSLPVPASAIEDVYPLTPMQEGLLLHTLLE
PGTGLYYMQDRYRINSALEPERFAQAWQAVIARHEALRASFCWNVGEDMLQVIHKPGSTP
IEYLDWSNDPESEQEPRLQTLLKQEREAGFDLLYQAPFHLRLIRVGEARYWFMMSNHHIL
IDAWCRSLLMNDFFEIYMALGEGRDAQLATPPRYRDYIAWLQRQNLNEARQWWQQNLQGF
ERTTPIPSDRPFLREHAGHSGGMVVGDCYTRLDARDGAQLRELAQAHQLTVNTFAQAAWA
LVLRRLSGDRDVLFGVTVAGRPVDMPQMQRTVGLFINSIALRVKLPEDDQRYSVRQWLSG
LLDSNMQLREYEYLPLVTIQEHSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLNATSDS
GRTHTNFPLTAVCYPGDDLGLHLSYDQRYFDETTVQGMLGEFKRLLLALVQGFHGDMADL
PLIGEQEREFLVEGCNQSEHDYPLESSYIELFEAQVAAHPQRTAASCLDQQWTYDELNRR
SNGLGHALIAAGVGADQPVALLAERNLDLLGMIIGSFKAGAGYLPLDPGLPSQRLSRILD
LSRTPLLVCTEACREQAIELLDGFDCQLLVWEEIPARGENPGIYSGPDNLAYVIYTSGST
GLPKGVMVEQRGMLNNQLSKVPYLALSDADVIAQTASQSFDISVWQFLAAPLFGARVDIV
PNTIAHDPQGLLEHVQTQGITVLESVPSLIQGMLAQDRIGLDGLRWMLPTGEAMPPELAH
QWLLRYPQIGLVNAYGPAECSDDVAFYRVDLASTRGTYLPIGTPTDNNRLYLLDGALELV
PQGAVGELCVAGTGVGRGYVSDPLRTAPVFVPNPFGAPGERLYRTGDLARRRSDGVLEYV
GRIDHQVKIRGYRIELGEIEARLHEQPEVRDAAVGVQEGVNGKHLVGYLVAADEALNPSE
RLDRIKQRLRTELPEYMVPLHWLWLDRLPHNANGKLDRNALPALEIGQLHSQDYLAPRNE
LETTLAAIWAEVLKVERVGVQNNFFELGGHSLLATQIASRVQTTLQRDVPLRAMFECSTV
AELAEYIEGLAGSEISAEKVDRLSDLMAELEGF
NT seq 12882 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttccccaaacgctggtccagtcccttcaacgtcgcgccgcg
cagacgccggaccaggtcgctctgcgcttcctggctgagtcggccgagcacagcgttgtg
ctcagttaccgcgatttggacctgcgcgcccgcaccatcgccgcggccttgcaggccaat
gcggacctgggcgaccgtgcggtgctgttgttccccagcggcccggattacgtcgcggcg
ttttttggttgcctgtacgccggggtcattgcggtgccggcttatccaccagagtcgacc
cgtcgtcaccatcaggagcgcctgctctcgatcatcagcgatgccgagccgcgcctgctg
ctgaccatcgccagcctcgccgatggcctggcgcagatcgaaaacgcgccaatggtattg
agcgtcgataccttgggcagcactgacacgtggatcgcccccgacctgcaccccgacgac
atcgcgttcctgcaatacacctccggctccaccgcgctgcccaaaggcgtgcaagtcagc
cacggcaacctggtggccaacgaagtgctgatccgtcgcggctttggcatcgacctcaac
ccggatgacgtgatcgtcagctggctgccgctgtaccacgacatgggcttgatcggcggc
ttgctgcaaccgatcttcagtggtgtgccctgcgtgttgatgtcgccggcgtacttcctt
ggtcggccattacgctggctggaggcgatcagtgaatacggcggtaccatcagtggcggc
ccggatttcgcctatcgcctgtgcagcgaaagggtcagcgagtcggcgttggagcgcctc
gacttgagccaatggcgcgtggcctattccggttctgaaccgatccgcctcgacaccctg
gagcgcttcgccgagaagttcgcggcctgcggttttactccgaataatttcttcgcgtcc
tacggcttggccgaagcgaccctgtttgtcgctggcggcattcgcggccaaggcatcccg
gcgctgcgcgtcgacgagcaggcattggctgccaaccgtgccgagccggggcagggcagt
gcgatcatgagttgcggcaccagccaacccgaacacgcggtgctgatcgccgacccgcac
accctcaccgaactggccgagaataacgtcggtgagctctgggccaccgggcctagcatc
gcccacggctactggcgcaaccccgaagccaccgccaagacctttgtgcaacatgctggc
cgtacctggctgcgcaccggcgacctgggttttatccgcagtggtgaggtgtacatcacc
ggccgcctgaaagacctgctgatcgtgcgcggtcataacctgtacccgcaggacatcgag
cagaccatcgagcgcgaagtggaagtcgtgcgcaagggccgggtcgccgcgtttgcagtg
aatgaccaaggcctggaaggtattggcattgccgccgaaatcagccgcagcgtgcagaag
atcctgccgcccgaagcactgatcaaggcgatccgccaagccgttgccgaggcgtatcaa
gaggcgccgagcgtggtggtgctgctcaaccctggcgccctgccgaagacctccagcggc
aaggtgcaacgtgcagcgtgtgcgctgcggtatgtcgatggcagcctcgaccgctatgcg
cagttccctgatctgcacgtgcaggtcagcgatgcagcgttgggctgcgaactgcaaaac
cagatcgccgcgatctggtgcgagcaactgcacgtcgcgacggttgcggccgatgatcat
ttcttcctgctcggcggcaactccatcaccgccacccaggtggtcgcgcgcctgcgtgaa
acactcggcctggagctgaacctgcgcatgctgttcgaagcgccaaccctggaaggcttt
gccgcctatgttgcgcagttgcagcaagacggcggtgtcgcccaaggcgccatccaaccc
ctgtcacgccaggaagacctgccccaatccctggcgcaaaaccgcctgtggatcacctgg
caactggacccccacagcagcgcctacaccatccccggcgccctgcgcctgcgcggcgag
ttggatgaagacgccgtgcgcttgagcttccaacacctggtccagcgccacgaagccctg
cgcacccgcttctacgaacgcgacggccaggccttccagcgcgtcgaggccaaggcggat
ttcgagctgcaagtcatcgacctcagcgacctgcccgctgccgagcgtgaaacccgcgcg
cagcagatccgcgaagacgaagcacgcacccagttcgacctggaaaaaggtccgctgctg
tgggtgacgctggttcgcctggatgatgaagatcaccaactgctggtcacgttgcaccac
atcatcgccgatggctggtcgctgaatatcctcatcgacgaattctcacgcttgtacgcc
gccgcaacccagggccaaacccttgagctgccgccgctggccctgcaatacgccgactac
ggcagctggcagcgccagtggctggccgaaggcgaaggccagcgccaactggcgtactgg
aaagcgcaactcggtgaagaacaccccaccctgagcctggccaccgaccacccgcgctcg
gcgcaacagcgcaacagcgcttcgcgccataccgtgcgccttggcgtgcacctcagcgaa
gcgattcgccagaccgcccaggcccaccaatccaccccgttcatgctgttgctggcggca
ttccagagcctgctctaccgctacagcggccagcgtgacatccgcatcggcgtgcccaat
gccaaccgcccgcgccaggaaacccaaggcttggtcggctttttcatcaacacgcaggtc
atgcgtgccgagctggatgggcgtctgccgttcaacgaactgttggcggcaacccgcgag
acggcaatggccgcacaggcccatcaggacctgcccttcgaacaactgctggaagccttt
ccgcaggcccgcgaacaaggcctgttccaggtcatgttcaaccaccaacaacgcgacctc
agcgctttgcgccgtctgccgggcatgctcgccgacgagctgccatggcacagccgcgac
gccaagttcgacctgcaattgcacagcgaagaagaccgcaacgggcgcctgagcctgtcg
ttcgactacgccgacgagctgttcgacagcgcgaccatccagcgcctggccgagcacttc
atcaacctgttgcaagccgcgtgtgaccagccgcagcaagccatcggcgatctcatactg
atgcaggcagacgagcagcaagcgtggagcgaagcgccgtgcgcacctgcccagcaatgg
ctgccggagctgctcaacaggcacacctcggacaacaccgcgctggtctggcagggcggc
agcctgacctttgcccaactgcacaccgaggccaaccgcctggcccactatctgcgcgac
aaaggcgtcggaccggacgtgtgcgtggcgatcgccgccgagcgttcgccgcaactgctg
atcggcttgctggcgatcatcaaggccggtggcgcctacgtgccgctggacccggattac
cctgccgagcgcctggcctacatgttggaggacagcggcgtgcacctgctgctgacccag
accgcgttgctggatcacgtgccagttgcctgcggcgtctgcgtgattgcgatggacagc
ctgcacctcgacagctggccgacccaaccaccgggcctgcatctgcacggcgataacctc
gcctacgtgatctacacctccggctccaccggccagcccaaaggcgtgggcaacacccat
gccgcgctggccgagcgcttgcagtggatgcaggccacctatcaactcaacagcaccgat
gtgctgatgcaaaaggcgccgatcagtttcgacgtgtcggtgtgggaatgcttctggccg
ctgatcaccggttgccgcctggtgctggccggccctggcgagcaccgcgacccgcaccgt
atcgcgcagttggtgcaggaacacggcgtgaccacgctgcactttgtgccgccgctgttg
cagttgtttatcgacgaaccgctggtagccaaatgcaccagcctgcgtcgcctgttttcc
ggtggcgaagcgttgcctgccgagctgcgcaaccgcgtcctggcgcagttgccggcggtg
caactgcacaaccgatatggcccgaccgaaaccgcaatcaacgtgacccactggcactgc
cgcgcagaagacggcgagcgctcgccgattggccgcccgctgggcaatgtgatctgccgc
gtgctggacgatcagctctaccctgtgccgctgggtgtgccgggtgaactgtgcatcggc
ggtataggtttggcccggggttacctggggcgcgccggattgaccgctgaacgttttgtc
gcagaccacttgggcacacgcctgtatcgcaccggtgaccgcgcccgttggagtgccgag
ggtgtgcttgagtacctcggtcgtctcgatcagcaggtcaaattgcgcggcttccgtgtg
gaaccagaagaaatcgaagcccgcatgctggccctggacggcatcgcccaagccgtggtg
ctggtgcgtgacgcgcagttgatcggctactacaccgcccatggcgaactagacgaacag
caggtgaaaaccgccctggccgccgagctgccggagtacatggtacccgcgctgctgatg
cgcctggacgccatgcccctgagccccagcggcaaactggaccgtcgcgcgttgccggag
ccggtgtggcaaacccgcgagcacattgaacccgaatcgccgttgcagcagcagatcgca
gccatctggcgtgaagtcctcggactgccaaaaatcggcctgcgcgatgacttcttcgcc
ctcggcggccactcgttgctggctacgcaaatcatctcgcgcacccgtcaggcctgtgac
gtggagttgccgttgcgcaccttgtttgaagccagcgagctgggcgcatttgccgagcag
gtcggcctgatccaggcgtcgggccaacgcaaccagcagacggctatcgccaaggtcgac
cgcagccaaccggtgccgttgtcctattcccagcagcgcatgtggttcctgtggcagatg
gaaccggacagcccggcctacaacgttggcggcatggcgcgcttgcgtggtgtgctggat
gtggggcgtttcgaggcggcgttgcaggccttgatcatgcgtcatgaaaccctgcgcacc
accttcccgagtgtcgacggcgtggcctttcagcaggtctcatcgcagaccagcctgcgc
atggactggcaggatttctcgggcctgaacgaaaccgagcgccagcagcgtctgcagcaa
ctggctgatcatgaagcgcacacgccgttcaatctggaaaccgggccgttgctgcgtgcc
tgcctggtcaaggccgccgagcgtgaacattatctggtgctgaccctgcaccacatcgtc
accgaaggctgggccatggacatctttgcccgtgaactcagcgcgctgtacgaagccttt
atcgacgagcgcgaatcgccgctggcgccgttgccggtgcaatacctggattacagcgtg
tggcagcgccagtggctggagtccggcgagcgtcaacgccagttggattactggaccacg
caactgggcagcgaacatccactgctggaactgcccggcgaccgcccacgcccaccggtg
caaagtcatcagggcgagctgtaccgcttcgacctcagcgatgacctggccgcccgcgtg
cgtgccttcaatgccgaacgcggcctgaccctgttcatgaccatgaccgccaccctggcc
gtgttgctctaccgctacagcggccagaccgacctgcgcattggcgcacccgtggccaac
cgcattcgcccggaaagcgaagggctgatcggcgcgttcctcaacacccaggtgctgcgt
tgccaactcaatgggcagatgaacgtcgctgaactgttcgagcacgtgcgccacacggtg
atcgaaggccagtcccatcaagacctgccgttcgaccacttggtagacgccctgcaaccg
ccgcgcagtgcggcgtacaacccgctgttccaagtgatgtgcaacgtgcagcgctgggaa
ttccagcaaagccgccaactggccggcatgaccgtggagtacctggccaacgatgcccgc
gcgaccaagttcgacctcaacctggaagtcaccgacctcgaccatcgcctgggttgctgc
ctgacctacagcaccgatctgttcgacgagccgcgcatcgcgcgcatggccgaacattgg
cgcaatctgctggaagccttgatcgccaatccgcagcagcgcctcagcgagttgccgtta
ctcacggccgcagagcagcgagcattgcaggacagcctgggtgccgaagcgggcgagcac
cgccttgatcaatgcattcatcaactgttcagccagcaagcggcagcccgaggcgatgca
cccgcgttgacgttcgccggcgttaccctcagctaccgtgaactcgacgcctgcgccaac
cgcctggcctggatgctgcgcgagcgtggcgtcggcccgcaggtacgcgttggcctggcg
ctgccgcgttccctggaaatggtcatcggcctgctggcgatcctcaaggccggtggcgcc
tatgtgccgctggacccggaatacccgctggaccgcttgcactacatgatcgaagacagc
ggcatcggcctgttgctcagcgatgcggcgatgtttacagccctcggcgcgttgcctgca
accgtggcgtgctggtgcctggaagatgacgcgccgctgctcgcccgctacccgtccgat
gcgctgccgtttatcagcctgccgcaacatcaggcgtacctcatctatacctccggttcc
actggcaagcccaagggcgtggtggtgtctcacggtgaaatcgccatgcattgcgcggcg
gtgatcgagcgtttcggcatgcgtgcggatgactgcgaactgcacttctattcgatcaac
ttcgacgccgccaccgagcgtttgctggtgccactgctcagtggggcccaggtggtattg
cgtgcccagggccagtgggacgccgaggaaatctgcgcgctgatccgcacccatcgcatc
aacatcctgggctttacgccgagctacggcagccagttggcgcagtggctggcgacccag
cagcagaccttgccggtgcgcatgtgcatcacgggtggcgaagcgctgaccggtgaacac
ttgcagcgtattcgcggcgcgttccaacctgaggtgttcttcaacgcctatggtccgacc
gaaaccgtggtgatgccgctggcaagcctcgcgcccgaacagttggaggagggcgctgcg
agcgtgccaatcggcagcatcatcggtgaccgcgtggcctatattctcgacgccgatctg
gcgttggtgccgcaaggtgcgaccggcgagttgtacgtcggcggcgccggcctggcccag
ggttatcaccagcgtccgggtatgacggcggagcgcttcgttgcggatccgtttgccacg
cacggcgggcgtctataccgcaccggcgacctggtgcgccaacgtgccgatggcctggtg
gagtacctggggcgtatcgaccatcaagtaaaaattcgcggtttccgcatcgaactgggc
gagatcgaaacccgcctgctggagcacgaggccgtgcgcgaagcggtggtgttggcgctg
gattcgccaagcggcaaacagttggtggcgtacctggtcagcgacgcagaccacagcgcg
ttgcgcgacgcgctcaaggcccacctcaaggcgcaattgccggactacatggtgcccacg
cacctgatcgtgctcgacagcatgccgctgaccgccaacggcaagctcgaccgccgggcg
ttgccgcaacccgaccctgatgctaatcgccaacagtacgtggcgccgcgcaacgagctg
gaaagcacattggcggcgatctggtgcgcagtgttgaacgtgcagcaagtcggcctggac
gataacttctttgaactgggcggcgactcgatcctgtcgatccaggtggtcagccgtgcg
cggcaagcgggcattcacttcagcccgcgcgacctattccagcaccagaccgtgcaaacc
ctggccgctgtcgccacgcgctccgagcaagtcaccgctgagcaaggcgtgctgacgggc
agctcgggcctcacgccgatccagcattggttcttcgatactgagattcctaatcgtcag
cactggaaccaggcgctggtcctcaagccgctgcaactgctcgacccgcatcgcctggag
caagcactgctggcggtactggaacaccacgacgccctgcgcctgagcttcacccagcgt
gacgcgcaatggcacgccgaacacctcgccgtaccgcaaggtggcgtgttgatgcaggcg
caagtacgcgacatgcaccatagcaccgcgctgttcaccgagacccaacgcagcctcgac
ctggcacacggcccgttgctgcgcgccttgctggtggatggccctgagggtcagcagcgc
ctgttgattgcgatccatcacttggtggtggacggcgtatcgtggcgcgtattgctcgaa
gacctgcaaaacgtttaccgccaactgagcgacggccaatccgtgagcctgccggccaag
accagcgcgctacgtgactgggctgcgcgcttgcaggcctacgccggcagcgaatccctg
cgcgaagagctgagcctctggcagcaccaactggccggcccgcaggccgaattgccggtg
gcacgcccgcaaggttcgctgcgcaaccgcgacgccgacaccgtcagcgtgcgcctggat
gtcgaacacacccgccaactgctgcaacaggccccgagcgcctatcgcacccaggtcaac
gacctgctgctgaccgccttggcgcgagtgttgtgccgctggagtggtcacgaatcgacg
ctgatccaactggaaggccacggccgcgaaaccctgttcgatgagatcgacctgacccgc
agcgtcggctggttcaccagcgcttaccccctgcgcctgaccccgcgagtcgggcagggc
gattcgatcaaggcgatcaaggaacaactgcgcgccgtgccgcataaaggcttgggctac
ggcgtgctgcgctacctggcggacgatctgtgcaagcagaccatggccgcgctgccgagc
gcgcagatcaccttcaactaccttggccagttcgaccagagctttggcgacgatgcgctg
ttccacccgctggatgagtccgcaggcctggcccatgatcccgatgcgccgttgcccaac
gagttgagtgtcgacagccaggtgtacggcggcgaactggtgctgcgctggaccttcagc
cgtgagcgctttgatcagcaaaccgtctgcgaattggccgatgcgtatctggccgaactg
caaagcctggtcgcgcattgccttgagggcaccgccggcggcctcacaccgtccgacttc
ccgctggcgcagctgacccagtcacaactcgacagcttgccggtaccggccagtgccatc
gaagacgtctacccgctgactccgatgcaggagggcctgttgctgcacaccctgctggaa
ccgggcactggcctctactacatgcaggaccgctaccgcatcaacagcgcattggagccg
gagcgtttcgcccaggcctggcaagcggtaatcgcccgccacgaagccctgcgcgcctcg
ttctgctggaacgtcggcgaagacatgctgcaagtgatccacaaaccgggcagcacgccg
attgagtacctggactggagcaacgatccggaaagcgaacaggagccgcgcctgcaaacc
ttactcaagcaagagcgcgaagccggtttcgatctgctctaccaggcgccgttccacctg
cggctgatccgcgtcggcgaagcgcgttactggttcatgatgagcaaccaccacatcctt
atcgatgcctggtgccgttcgttgctgatgaatgacttctttgaaatctacatggccctc
ggcgaaggccgcgacgcgcaactggccacgccaccgcgctaccgcgactacatcgcctgg
ctgcaacgccagaacctcaacgaggcgcgccagtggtggcagcagaacctgcaagggttc
gagcgcaccacgccgatcccgagcgaccggccgttcctgcgtgaacacgcgggccacagc
ggcggcatggtggtgggcgactgctacacccgcctcgatgcccgcgacggcgcgcaactg
cgcgaactggcgcaggcgcatcagctgacagtcaacacctttgcccaggcggcatgggcc
ctggtgctgcgccgtttgagcggcgatcgtgacgtgctgtttggcgtcaccgtggccggc
cgcccggtggacatgccgcagatgcaacgcactgtcggcctgttcatcaacagcatcgcg
ctgcgggtgaaactgcccgaggatgaccagcgttacagcgtgcgccagtggttgagcggc
ctgctcgacagcaatatgcagctgcgcgagtacgaatacttgccgttggtgacgatccag
gaacacagcgaactgcccaagggccagccgctgttcgacagcctgttcgtgttcgaaaat
gccccggtggaagtctcggtgctggaccgcgcacaaagcctgaatgccacttcggattcc
ggccgcacccacaccaatttcccgctaaccgctgtgtgctatccgggcgacgacctcggt
ttgcatctctcctatgaccagcgttatttcgacgaaaccaccgtgcaaggcatgctcggc
gagttcaagcgcctgctgctggcgctggtgcagggcttccatggcgacatggccgacctg
ccgctgattggcgagcaggagcgcgagttcctagtggaaggctgcaaccagagcgaacac
gactacccgctggagagcagctatatcgagctgttcgaagcccaggtggccgcgcatccg
cagcggaccgccgccagttgcctggaccagcaatggacctatgacgagttgaaccggcgc
agtaatggcctgggccacgcgctgattgcggcgggcgtgggcgctgatcaaccggtggcg
ttgctggccgaacgcaacctggatttgcttggcatgatcatcggcagcttcaaggccggc
gccggttacctgccgctggaccccggcctgccgagccagcgcctgagccgcattcttgac
ctgagccgcacaccgttgctggtgtgcaccgaggcctgtcgcgagcaagccatcgagttg
ctggacggcttcgactgccagttgctggtgtgggaagaaataccggcgcgtggtgaaaac
cctggcatctacagtggcccagataaccttgcctacgtgatctacacctcgggctccact
ggcctgcccaaaggcgtgatggtcgagcagcgcggcatgctcaataaccagttgagcaag
gtgccgtacctggccttgagcgacgccgatgtgattgcgcaaaccgcgtcacagagcttc
gatatttccgtgtggcaattcctcgccgcaccgctgtttggcgcgcgggtggacatcgtg
ccgaataccattgcccatgatccacagggcctgctggagcatgtccagacccaaggcatc
accgtgctggaaagcgtgccgtcgctgatccagggcatgctggcccaggaccgtatcggc
ctggacggcctgcgctggatgctacccaccggcgaagcgatgccgccggagttggcgcat
caatggctgttgcgctacccgcagattggcttggtgaatgcttatggcccggcggaatgc
tcggacgatgtggcgttctaccgcgtcgacctggcctctacccgtggcacttacttgccg
attggtacgcccaccgacaacaaccgtttgtacctgttggacggtgcgctggagctggtg
ccccaaggcgctgtgggcgagctgtgcgtcgccggtacgggcgtcggtcgcggctacgtc
agcgacccgctgcgcaccgccccggtgtttgtgcccaaccccttcggcgcaccgggcgag
cgcctgtaccgcaccggtgacctggcgcggcgtcgcagcgatggggtgctggaatacgtc
gggcgtatcgaccaccaagtgaagattcgcggctaccgcatcgaactgggtgaaatcgaa
gcgcgcctgcacgaacaaccggaagtgcgcgacgcggcggtcggcgtgcaggagggcgtc
aacggcaagcatctggttggctacctcgttgccgcagacgaagcgctcaacccaagcgaa
cgcctcgaccgcatcaagcagcgtctgcgcacagaactgccggaatacatggtgccgctg
cactggctatggctcgaccgcctgccgcacaacgccaacggcaaactcgaccgcaacgcc
ctgccggccctggagatcggccagctgcacagccaggactacctggcgccacgcaacgaa
ctggaaaccaccctggccgcgatttgggccgaggtgctgaaagtcgaacgggtaggggtg
cagaacaacttcttcgaactgggcgggcactcgttgctggccacgcagattgcttcgcgg
gtgcagacgactttgcagcgggatgtgccgctgcgggcgatgtttgagtgcagcacggtg
gcggaattggctgagtatattgaggggttggcggggagtgagatcagtgcggagaaggtg
gatcggttgagtgatttgatggcggagttggaggggttttga

DBGET integrated database retrieval system