KEGG   Pseudomonas trivialis: AA957_24710Help
Entry
AA957_24710       CDS       T04006                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ptv  Pseudomonas trivialis
Pathway
ptv00250  Alanine, aspartate and glutamate metabolism
ptv00280  Valine, leucine and isoleucine degradation
ptv00410  beta-Alanine metabolism
ptv00640  Propanoate metabolism
ptv00650  Butanoate metabolism
ptv01100  Metabolic pathways
ptv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ptv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AA957_24710
   00650 Butanoate metabolism
    AA957_24710
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AA957_24710
   00280 Valine, leucine and isoleucine degradation
    AA957_24710
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AA957_24710
Enzymes [BR:ptv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AA957_24710
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AA957_24710
Amino acid related enzymes [BR:ptv01007]
 Aminotransferase (transaminase)
  Class III
   AA957_24710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKS09183
UniProt: A0A0H5AGC1
LinkDB All DBs
Position
5431573..5432865
Genome map
AA seq 430 aa AA seqDB search
MNSKVDETPHLLRQREQFVPRGLVTAHPLVIDRALGAELWDVDGKRYLDFVGGIGVLNIG
HNHPKVVAAVQAQLQKVSHACFQVVAYQPYLDLAQRLCEMVGGEEAYKAAFFTSGAEAVE
NAVKIARAHTNRSAVIAFRGGFHGRTLLGTTLTGMSQPYKQNFGPFAPEVFHTPYPNAYR
GVTSEVALKALDELLATQVAPERVAAIIIEPVQGDGGFLTAPPEFLQALRALADKHGIVL
ILDEIQTGFGRTGTWFGFQHAGIRPDLVTVAKSLAGGLPLSGVVGKAHIMDAPLPGGLGG
TYGGNALACAAALAVIEAFEQEQLLARSQVLGERLRQGLLGLQARFPNIGDVRGTGFMLA
IELIKDDPERTPDADLNQRVIDAARAGGLLVIKCGVHRNVLRFLAPLVTTEAQVDEALQI
LDAALARVLN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcaaagtcgacgaaacccctcatttgctccgtcagcgcgagcagttcgtgccc
cgtgggctggtgaccgcgcatccgctggtgatcgaccgcgccttgggcgccgagttgtgg
gacgtggatggcaagcgttacctggacttcgttggcggcatcggcgtgctcaatatcggc
cacaaccaccctaaagtcgtggcggccgtgcaggcccagctgcaaaaggtgtcccacgcg
tgtttccaggtcgtggcttaccagccttatctcgacctggcccagcgtttgtgtgaaatg
gtcggcggtgaagaagcctataaagccgcgtttttcacctccggcgccgaggcggtagaa
aatgcggtgaagatcgcccgcgcccacaccaatcgctcggcggtgatcgcctttcgtggc
ggcttccatggccgtacgttgctgggcactacgctcacggggatgagccagccctacaaa
caaaacttcggcccgtttgcgccggaggtattccacacgccctacccgaacgcttatcgc
ggggtgaccagcgaggtcgcgctcaaggcgttggatgaattgctggcaacccaggtcgcg
ccggagcgcgtcgcggcgatcatcattgaacccgtgcagggcgacggtggtttcctcacg
gcgccgccggagtttctgcaggcgctgcgcgcgttggccgacaagcacggcattgtgttg
atcctcgacgagatccagaccggcttcggtcgtaccggcacgtggttcggtttccagcac
gccggcatcaggcccgacctggtcaccgtggccaagagcctggccggcggcttgccgttg
tccggcgtggtcggcaaggcgcacatcatggatgcgccgctgcccggtggcctcggcggt
acttatggcggtaacgccctggcctgtgcggcggcgctggcggtcatcgaagcgtttgaa
caagagcaattgctggcacgcagccaagtgttgggcgagcgtttgcgccagggattgctc
ggtttgcaggcgcgcttcccgaacatcggcgacgtacgcggcaccggttttatgctggcc
atcgaattgatcaaggatgaccctgagcgcaccccggatgccgacctcaaccaacgggtg
atcgacgccgctcgcgccggtggtttgctggtgatcaagtgtggcgtacaccgcaacgta
ttgcgcttcctcgcgccgttggtgaccaccgaggcgcaggtcgacgaagccttgcagatt
ctcgacgcggccttggcacgggtcttgaactga

DBGET integrated database retrieval system