KEGG   Pandoraea thiooxydans: ABW99_02125Help
Entry
ABW99_02125       CDS       T03947                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ptx  Pandoraea thiooxydans
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ptx00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABW99_02125
Enzymes [BR:ptx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ABW99_02125
Transporters [BR:ptx02000]
 Other Transporters
  Pores ion channels [TC:1]
   ABW99_02125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1261347..1262084)
Genome map
AA seq 245 aa AA seqDB search
MRYELYYWPSIQGRGEFVRLALEEAAAEYIDVARAPSDRHGGVSAMIGIFQDAGHPHSPF
APPFLRAGKQLIAQTANILLFLGPRHGLVGQSETRRLWTNSLQLTIADMLTEVHDTHHPI
GSGLYYEEQQSEALRRAEDFLRHRLPKFLAYFERVLADNPAGERYLVGNALSYADLSMFQ
MIEGLRYAFPHAMSGAARAYPRLIDLHDRVAARARIAAYLASSRRIPFNDTGIFRHYPAL
DRPAR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatgaactgtattactggccgtctatccaggggcgcggcgaattcgttcggctc
gcattggaggaggccgccgccgagtacatcgatgtggcgcgcgcgccgtcggaccgacac
ggtggcgtgtcggcgatgatcgggatttttcaggatgccggccacccgcactctcccttc
gcgccgccgttcctgcgggccggcaaacagctgatcgcgcaaaccgccaatatcctgctg
tttctgggacctcgccatggcttggtcgggcagagcgagaccaggcgcctgtggacgaac
agcctgcagttgaccattgccgacatgctcaccgaggtgcacgacacacaccacccgatc
ggcagcggcttgtactatgaagaacagcaatcggaggcgctgcggcgcgccgaggacttt
ttgcggcaccggctacccaagttcctcgcctatttcgaacgggtattggcggacaatccg
gcgggcgagcgctatctggtcggcaatgcgctgtcgtacgcggacttatcgatgtttcaa
atgatcgaaggactgcgttatgcgttcccgcacgccatgagcggcgccgctcgtgcctat
ccccgcctgatcgatctgcacgaccgggtcgccgcgcgagcgcgcatcgccgcttatctg
gcctcctcgcgccgcatcccgttcaacgatacgggcattttccggcactatccggcgctc
gaccgaccggcccgatag

DBGET integrated database retrieval system