KEGG   Pandoraea vervacti: UC34_15530Help
Entry
UC34_15530        CDS       T03688                                 

Definition
(GenBank) hypothetical protein
Organism
pve  Pandoraea vervacti
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3542672..3555985)
Genome map
AA seq 4437 aa AA seqDB search
MNDALRLPVPFDFVPSMAASSGAAVESIGPIEHMVDLLRARARLEPEREALRALSSDDGE
GQALTCAGLDTRARAVAATLQRLSAGRTHGERGVLLMPTGLDYVAGFFGCLYAGAIAVPA
FPPESARAQHLARVRSILSDANARFVLTDRRHRDAMLAFGDAAPELRDVEIVVVDEIDDA
LAAQWQETSVSPSDLAFLQYTSGSTSTPKGVMVSHANLMANEAAIVAGLGMTRDDTMVSW
LPLYHDMGLIGGLLSPIYRGARLILMSPQFFLERPVRWLRAIDKFGGTVSGGPDFAYRLC
AQRIDAATIGALDLRRWRLAFSGSEPVRHDTLVEFCEAFAPAGFDPKAVYPCYGLAEATL
FVTGGRRGDGMTAVEFDPGALARQRADVCRDAGTMLVGCGATPLGHDVRLMTWSDSSDVA
PSPVAQGEVGEIWVSGPSVAQGYWRNEEASARTFVQASEESGRRWLRTGDLGFVHEAQLY
ITGRCKDVIIMRGHNLYPQDLEKAIEADVELVRKGRVTAFAVDIDGEPGIGVAAEVGRGV
QKMVPAQTLAEAIAVAVADVCQQAAAVVVLLNPGALPKTSSGKLQRSACAKGWRDGTLDA
WATWRNGVILDKDAGTPPPSAVGHDSARAHDTLYETVASIWCEVLGRTSIGADDHFFLCG
GSSLLAMQVLARVRERLGRKATPASLYEHARLGEWVQALAKVPPASDTQDATASRTIPSA
TPLAETSDVRVFRQSFAQSRLWFVHRLDPANSAAYHVGGQLRINGCFDEAVFAQALDIVT
ARHDALRTTFDERDGVAVQVVHRRADIALTVHDLTGDPNPEAAAASLTRTLLAEPFAPES
APPWRVASLRMSRDVLTDQHDQHRIVFVLHHLLTDAWSMTLLVDELAHAYRAYANGATPD
FEAVPVQPGDHAHWQHAHIGGAALERQLDWWQARLPEPSPFLTLPFDRARGALRSGTGRT
LAFDLPAGLTRDVLTYAAQRKATPFVVLAAAFQWLLHRYAGETDIRIGVPIAQRDIAGLE
RMLGCLVNTQVWRAEVDPTAGFDQLVAQVRDGALAAQAHRDAPFERVVERIAPQRSLGQS
PLFQVMLNHHVANAASSRVAAGWPTELNVVAEPLTGGAQYDLALDIDEFHDGAADGDRPI
GARPDPLDGVKLRARLTFPTDLFDVETIERLGAHWCAGLATLLAMPTRPLAALDVAFEGS
LDGNRRTAAPEVSQSLAFQSVPALVDAQARQQPAAIALRDEAGTLTYAELVCAANRVAHW
LLSHGATPEARIGLAMSRQTAMITGLLGIMKAGCAFVPLDPSYPAQRLAQIIEDAGISLV
LTETSLMDAPWMPARHAALTDIVAERTLSSDTPPLSLHPDQLAYLIYTSGSTGVPKGVAV
AHGPLAMHCVATGAQYRLTPHVCELHVLSINFDGAHERWMAPLICGASLFIADERHWAPQ
TMLDVMRRHGVTNAGFPSAYLSRLATSAATGAPALRLLSFGGEAMPWPALRAAQAMFRPA
QTINGYGPTECVMTPVAWSIDGDLDAQPAVQRTAQAYAPIGVPVGRRRAWVLDPWLGEVP
PGAVGELYLGGEGIARGYFGRPGLSAERFVPDPRGEPGARMYRTGDRVRRLADGTLVYLG
RFDQQVKVRGFRIEPGEVETQLLREAGVDDALAVVVAGPTSDQLVAYVAGKGLDGELLRM
ALADRLPDYLVPSLVIVLDTLPKLPNGKRDRAALPAPVWGSAGGQAPQGATEIALAAIWQ
TLLHVPSVSRDDNFFALGGDSIVAMQMVSRARQAGWQIGAQDVFRHQTLARVAAQALPTR
SAGDETPAPEPMQGDVPLTPVQAWFFRQDVASRDHWNQWIEVRLPHGADGTDVSTLREAL
ARVATHHDALRLRFTERDGRWHARYVAPHAADDLLWHAAMCDEAQLAERLAQAQRSLSLA
DGPLLRALLVRTEDGRLRCFLVAHHLVIDGVSWRILLADLQTALDQRKHAPDEEGALPAA
GESMRAWAQRWHDWTHTEAAQTALGVWQQSLQGALDTIDIAKDNLVERGAGEIEQTWHAD
IAQPLTGLRRVRLHEVLGAAVIHTLGKRVDAARYVVHVEGHGRGGEGAGDLSRTLGWFTA
AWPLAVDVGATPHATLAAVRAAWRRAPQAGASYGALRYLGTPVAQQTLAALPQGLVTVNF
VGRTVSREPEDGVVAIVDGGLSHAPEVAPPNWLTFDVWQRDDTLHVVCRYDRSRLAGEDV
QTLIDDIGATLLAFAQTLPGNEPIVAEDFPHAGLTGEQLAALPAPAQQLEAVVPATSMQQ
GLLFHAQQQGTADPYFYQKGFVIEGELDVDAFAQAWRDTIVRHAALRTAYATDVGEQPLL
LVYAKETVTSGAGWLPQEDWRGLTAAEQHARLDARFAAERAAGFSFAQAHRVRMALVRLA
QARWWLLWSSHHVALDGWSTGLVLSDVMSRYTACARGGGQPQADLEAAPSFAEFAVWQRE
RDATASLAHWRQLLDGVGAPTPLPAAHAIAQGAARPTPTSRHGEVAWTLAPGQWEAWCDA
ARRAGVTPGALCQGAWAMLLARHAGLRDVVFGVTASGRSAAVPGIERMAGLFINTLPVRA
KLEAHRTVAQWLRALQTQTAQSRDHEHVALSAITREAQREGEGADGALFESIVVFENYPL
DAALLGQRADGLRLSLLEREPQARNNYPLSLIVEQHDGLRLVLAFARERFDEAAVRMLGE
QFVALLGALASGIDGPLARIGLGDSVAQTTDAVVWPTLDLLDVWEAHVARDGHALAAEGE
DGALRRAELDGLANRLAAALQARGIGPEDRVAVCLPRSAAWVGAILGIWKAGAAYVPLDP
AQPVERLDRLVNASGAKAVIVDEHAPAITQSPTIRWHALTSTAPPDGSATPRPVRTHASQ
AAYVIYTSGSTGEPKGVVVSRGALHNYVQAVATRLSESGPDAGDRPAGGFAMASTVAADL
GHTTLFGALALGRPLYLVPQACAFDAQRFAQWCAARPIDVLKIVPGHLKGLLDAAGESVL
PRAVLVTGGESLDPDFVGHIRAARPSLAVLNHYGPTETTVGALTYALPQGALTTSVPVGY
PLANLHAYLLDTDLNPVPPGVAGELYLGGAGLARGYLGAPGQTAERFVPDPWRAGGRLYR
TGDRAVQRADGAYVYLGRMDDQVKIRGYRVEPAEVAQAMRRVPGVTDAVVVARHDGPGGA
WLHGVYTGGASADVVRAALSAALPAAWVPARLDGVDRLPLTANGKVDRRALAALGDPGEA
TTELPHDGTEAEIASIWCQVLKRDRVGRHDAFFDIGGDSILALQVIARLRKRGLKVGPQH
LASHPTIARLATLAAPVPAAASSDATPVQVGSPGPTRGDAHRTRFPLSSSQRRVWLETQL
APREGAYHIAGALRLEGPLQAHALERALHTLSEWHDALRTTIVVNDVDGAPQQCVHATLP
VAFTRDADIPPGAGDAAVQARLDALTRAPFDLVAGPLWRVHLMPLGQHSHALMLVMHHLI
SDGWSMNLLIRDLAHAYRAHASGVSPARASVGAPAPQVRYGDYAVWQREQLASPAQAEQL
AYWRAQLGTTHPELALPFDRARPATRDGAGASIDLTVSPDLPARLDRFAREHGVTRFMVM
AAAFHLLLHRVTGDMDIRTGLPVAGRSHESVEPVVGFFVNTQVLRSQIDTPTTFASLVAQ
IRDGLLAAQQHADVPFERLVEHLAPVRSVSRHPLFQVSLNHQKRAFAPLSDLAGLTMRAI
ERRAHHVQVDLALDTEEDDAGALRGWLTYACDVFDAATVRRLGDQWLALLDVAMAQAQVP
VARLAMCGHDAAPPSRRHPRTRVAVPMPVHLAIDAQAAAHGDAIAVNDGQSQLTYAELVS
RANRVAHALIRAGVAPEARVGLAMSRGTDLIVAMLGILKAGAAYVPLDPAYPADRLCYMV
ADAGVTHAITQASLMHAPWLPSGAQTIESLLTDDTLPVCAPAREVHVDQLAYVIYTSGST
GRPKGAQLTHRNLMQLLLGTSRDFAFDADDVWTMFHTYAFDFSVWEIFGALVHGARLVVV
SHDTARDPVAMWSLVRREGVTVLNQTPSAFYQWLGAMPDDVVTTTLRHVVFGGEALTPAR
LAAWWQRFGDATRLTNMYGITETTVHVSRRVLRAEDTAGSPIGEPIADLDWRVLDAGLND
VPPGVAGDLYVCGEGLARGYLGQAGLTAERFVPDPYGAPGERMYRSGDRARRLVDGTLDY
LGRGDAQVKLRGFRIEPGEIEAHLLRHDDVTDAAVVVRDDGAGEQLVAYVVSPVDASELW
PRLRSHLEGQLPTYMAPGLWMRLDTLPLTPNGKLDRRALPVPEAVGATCFEDPHEGSEQL
VASIWQDVLGVPRVSRHDDFFVLGGHSLLATQVVSRLRDALSLDVPLRTLFEASRLSALA
ETLDALVAQARTSASHPDINAAADLTDATDGALQAALREMESLSPEALQALLGSEAR
NT seq 13314 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgctcttcgcttgcccgtccccttcgattttgtcccgtccatggccgcttcg
tccggtgctgcggtcgaatcgatcggccccatcgaacatatggtcgacctgctgcgcgca
cgcgctcgtctcgagcctgagcgcgaggcgctgcgtgcactgtccagcgacgacggcgag
gggcaggcgctgacctgcgcggggctcgacacccgtgcccgagcggtcgcagccacgctg
caacgtctctcggcgggccgcacgcatggcgagcgcggagtgttgctcatgcccacggga
ctggattacgtggcggggttcttcggttgtctctacgcgggggcgatcgccgtgccggcg
tttccgccggaatcggcccgtgcgcaacatcttgcccgcgtgcgctcgatcctgtccgat
gcgaacgcgcgcttcgtgctgaccgaccgtcgccatcgcgacgccatgctggcgttcggc
gacgcggcgccggaactgcgcgacgtggaaatcgtggtggtcgatgagatcgacgacgcg
ctcgccgcgcaatggcaggagacgagcgtctcaccttccgatctggccttcctgcaatac
acctcgggttcgacatcgacgccaaagggcgtgatggtcagtcatgccaacctgatggcc
aacgaagcggccatcgtggcggggctgggcatgacgcgcgacgacaccatggtgagctgg
ctgccgctttatcacgacatggggctgattggcggactgttgtcccccatttatcgtggg
gcgcgtctgatactgatgtcgcctcagttctttctggagcgacccgtgcggtggttacgc
gccatcgacaagttcggcggcaccgtcagcggcggccctgactttgcgtatcggctgtgt
gcccagcgcatcgacgccgcgaccatcggcgcactggatttgcgcaggtggcgtctggcc
ttctccggctcggagccggtgcgccatgacacgctggtcgaattttgcgaggcattcgcc
ccggcgggcttcgatccgaaggcggtgtatccctgctacggcctggccgaggcgacgttg
ttcgtcaccggggggcggcgcggcgacggcatgaccgccgtcgaattcgaccctggcgcg
ctggcgcggcaacgcgccgacgtctgtcgcgacgcggggacgatgctcgtgggttgcggc
gcgacgccgctcgggcacgacgtgcgcctcatgacatggagcgattcgtccgacgtcgcc
ccgtcgcctgtggcgcagggggaagtgggggagatctgggtgagcgggccgagcgtggcg
caaggctactggcgcaacgaggaggcgagcgcgcgtacgttcgtgcaggcgagtgaggag
agtggcaggcgttggctgcgcaccggcgacctcgggttcgttcacgaggcgcagctctac
atcacgggccgttgcaaggacgtcatcatcatgcgcggccacaatctgtacccgcaggat
ctggagaaggccatcgaggccgacgtcgaactcgtgcgcaagggccgcgtgacggccttt
gccgtggacatcgacggcgagccgggcatcggcgtcgcggccgaagtgggacgcggcgtc
cagaaaatggtgcctgcgcaaacgttggcggaagcgattgccgtggcggtcgccgacgtc
tgccagcaggccgctgccgtcgtggtgttgctcaacccgggggcgctgccgaagacgtcc
agcggcaagttgcagcgcagtgcgtgtgcgaagggctggcgcgacgggacactcgacgcg
tgggcgacctggcgcaacggcgtgatcctcgataaggacgccgggacgccgccaccgtct
gccgtcgggcacgacagcgcccgcgcgcacgataccctctacgagaccgtcgccagcatc
tggtgcgaagtgcttgggcggacgtcgatcggcgcagacgaccatttcttcctttgcggc
ggcagttcattgcttgcgatgcaggtgctggcacgcgtgcgtgaacggctcgggcgcaaa
gcgacgccggcatcgctgtacgagcacgcgcggctgggcgagtgggtgcaagcgctggcg
aaggtgcccccggcgtccgacacgcaagacgccaccgcttcgcgcaccattccgagcgcg
acaccgctggcagagacgtcagacgtgcgggtgtttcgtcagtcgttcgcgcagtcgcga
ctgtggttcgtccatcgcctcgatccggccaacagtgcggcctatcacgtcggcggccag
ttgcgcatcaacgggtgcttcgatgaagccgtgtttgcgcaagcgctggacatcgtcact
gcgcgccacgacgccttacgcacgacgttcgacgagcgtgacggcgttgcggttcaggtc
gtccacaggcgcgccgatatcgcgctcaccgtgcacgatctgacgggcgatccgaatccc
gaagcggccgccgcatccctcacgcgtacgctgctcgccgaaccctttgcgcccgagtcg
gcgccgccgtggcgcgtggcttcgctgcgcatgtcgcgcgatgtcctgaccgatcagcac
gatcagcaccggatcgtcttcgtcctgcaccacttgttgaccgacgcctggtcgatgaca
ttgctcgtcgatgaactcgcacacgcttaccgcgcctatgcgaatggcgccacgcccgat
ttcgaagccgttccggtgcagccgggcgatcacgcgcactggcagcatgcgcacatcggc
ggcgccgcgctcgagcgccagctcgattggtggcaggcacgtctgcccgaaccctcgccg
ttcctcacattgccgttcgaccgggcgcgcggtgcgttacgcagcgggacgggccgcacg
ctggcgttcgatcttccggccggtctcacgcgcgacgtgctgacgtacgccgcacaacgc
aaggccacgcctttcgtggtgctggcagccgcattccaatggttgttgcatcgctatgcg
ggcgagaccgacattcggatcggtgtgccgatcgcgcagcgcgacatcgcagggctcgaa
cgtatgctcggctgtctcgtcaacacccaggtctggcgtgcggaggtcgacccgacggcc
ggcttcgaccagttggtcgcacaggtgcgcgacggggcactggctgcgcaggcgcatcgc
gacgcgccgttcgagcgtgtggtggagcgtatcgcgccgcagcgcagtcttggccagtcc
ccgctctttcaggtgatgctcaatcatcatgtggccaacgccgcatcgtcgcgcgtcgca
gccggttggccaacggagctgaatgtcgttgccgagccgctgaccggcggtgcgcaatac
gatctggcgctggacatcgacgagttccatgacggggcggccgacggggaccgtccgatc
ggcgcgcgccccgatccgctcgacggcgtgaagctgcgtgcccgtctgacattcccgacc
gatctgttcgacgtcgagaccatcgaacgacttggcgcgcactggtgcgccgggctggcg
acattgctggcgatgccgacgcggccgctggcggcgctcgacgtggcgttcgaaggctcg
ctggacggcaaccgtcgcacggcggcgcccgaggtgtcgcagtcactggcgtttcaaagt
gtgcccgcactcgtcgacgcgcaagcccggcaacagccggcggccattgcgctgcgtgac
gaggcgggcacgctgacctatgccgaactggtgtgcgcggcgaatcgcgtcgcccattgg
ctgctgtcgcacggcgcaacgcccgaggcgcgcatcggtctggcgatgtcgcgtcagacg
gccatgatcaccggcctgctcggcattatgaaggcgggctgcgcgttcgtgccgctagac
ccatcctatccggcgcaacggttggcgcaaatcatcgaggacgccgggatttcgctggtg
ctcaccgagacatcgttgatggatgcgccatggatgccagcgcgccatgccgccctgacc
gacatcgttgccgagcgcacgctatcgagcgatacgccgccattgagcctgcacccggac
caactcgcctatctgatctatacgtccggctcgacgggcgttcccaaaggcgtggcggtc
gcgcatggaccgctcgccatgcactgcgtggcgacgggcgcgcagtatcgtctcacgccg
cacgtctgcgagctgcacgtgctgtcgatcaacttcgacggtgcgcacgaacgatggatg
gcgccgttgatctgcggggcgtcgttgttcatcgccgacgaaaggcactgggcgccgcag
acgatgctcgacgtcatgcgccgtcacggcgtgaccaacgccggcttcccgagcgcttac
ctgagtcgtctggccaccagtgccgcgaccggggcgccggcgcttcggctgctgtcgttc
ggtggcgaagcgatgccgtggcctgcgctgcgcgcggcgcaggcgatgttccgtcctgcg
cagacgatcaatggctatggcccgaccgaatgcgtgatgacgccggtcgcgtggtccatc
gacggcgatcttgacgcgcaaccggcggtgcaacgtaccgcgcaggcctatgcgccgatc
ggcgtgcctgtgggccggcgtcgcgcgtgggtgctggatccgtggctgggcgaagtgccg
cctggcgccgtcggagagctgtatctgggcggcgagggtatcgcgcgaggctacttcggt
cgcccggggctgagcgccgagcgtttcgtgccggacccgcgcggcgagccgggcgcgcgg
atgtaccgcaccggtgaccgtgtgcgacgtctggccgacggcacgctcgtgtacctcggg
cgtttcgatcagcaggtgaaggtgcgcggctttcgcatcgaacccggcgaagtcgagact
cagttactgcgcgaagcgggcgtcgacgatgcgctggccgtcgtggtggccggaccgacg
agcgaccagctcgtggcatacgtggcgggcaaggggctcgatggcgaactgctgcgcatg
gcgttggcggaccggctgccggactatctcgtgccgtcgctcgtgatcgtgctggacacg
ttgccgaagctgcccaacggcaagcgggaccgtgccgcgttgccggcgccggtgtggggc
agtgcgggcggacaagcgccgcagggcgcgacggagattgcgctcgccgccatttggcag
acgttgctgcacgtgccctcggtcagtcgcgacgataacttcttcgcgctgggcggagac
tccatcgtcgccatgcagatggtcagtcgcgcgcgtcaggcaggctggcaaatcggcgcg
caggatgttttccgtcatcagacgctagcgcgcgtggccgcacaggcgcttcccacgcgc
agcgccggggatgaaacccctgcgccggagccgatgcagggcgatgttccgctcacgccc
gtgcaggcatggtttttccgacaggacgtggcgagtcgcgatcactggaaccaatggatc
gaagtgcggttgcctcatggagcggacgggacggacgtgtcgacgcttcgcgaggcgctg
gcgcgcgtggcgactcatcacgatgcgttgagactgcgcttcaccgagcgcgacggccgt
tggcatgcccggtacgtcgcgccgcacgcggccgacgatctgctctggcatgccgccatg
tgcgacgaagcgcagttggccgagcgcctcgcgcaagcccagcggagcctgtcgctcgcc
gacggcccgctgttgcgtgcgctgctggtgcgcaccgaggacggacgactgcgttgcttc
ctcgtggcgcatcatctggtgatcgacggggtgtcgtggcgcattttgcttgccgatcta
caaacggccctcgatcagcgcaagcatgctccggacgaggagggcgcgttgcctgccgcg
ggcgagtcgatgcgcgcctgggcgcagcgctggcacgactggacgcacaccgaggcggcg
cagacggcgctcggcgtctggcagcaatcgctgcaaggggcgctcgacacgatcgacatc
gcgaaggacaaccttgtcgaacggggcgccggtgagatcgaacagacgtggcacgcggac
attgcgcagccactgacaggattgcgccgcgttcgcctgcacgaggtgctcggtgccgct
gtgatccatacgctgggtaagcgtgtcgatgccgcgcgctatgtcgttcacgtagaaggt
cacggtcgcggcggcgagggcgcaggcgacctgtcccgcacgctgggctggtttacggcg
gcctggccgctcgccgtcgacgttggggcgacgcctcacgcgacgttggccgccgtgcgc
gccgcctggcgacgcgcgccgcaggcgggcgcgagctatggcgcactccgctatctcggc
accccggttgcgcagcaaacgctggcggcgctgccgcagggactcgtcaccgtgaacttc
gtggggcgcaccgtcagccgtgagcccgaggatggcgtcgtcgccattgtcgacggcgga
ctctcgcatgcgccggaggtggccccccccaattggctgacgttcgacgtctggcaacgt
gacgacacgctgcatgtggtttgccgctatgaccgttcgcgtctggccggtgaagacgtg
cagacgttgatcgacgacatcggcgcgacgctcctcgcatttgcgcagacgctgcccggc
aacgagccgatcgtcgctgaggatttcccgcacgcggggctgaccggcgaacaactggcg
gcgctgcccgcgcctgcgcaacagctcgaagccgtagtcccggccacatcgatgcagcag
ggcctgctctttcacgcgcagcaacaaggcacggctgacccgtatttctatcagaagggc
ttcgtcatcgagggcgaactcgatgtcgatgcgttcgcgcaggcgtggcgcgacaccatc
gtgcgccatgcggcgctgcgcaccgcttatgcgaccgacgtgggcgagcagccgctgctg
ctggtctatgctaaggaaacggtcacgtccggcgccgggtggctgccgcaggaggactgg
cgtggcctgacggccgccgaacagcatgcacgtctcgacgcgcgtttcgcggccgagcgc
gccgcaggcttttcgttcgcgcaggcgcatcgtgtgcgtatggcgctggtgcgtctcgcg
caggcccgctggtggctgctctggagcagtcaccacgtcgcgctcgacggctggagcacc
gggttggttctgagcgacgtcatgtcgcgatataccgcatgcgcgcgtggcggcgggcag
cctcaagccgatttggaagcggccccatcgttcgcggaatttgcggtctggcaacgcgag
cgcgacgccacggcgtcgttggcgcactggcgtcagttgctcgacggcgtgggcgcgccg
acgccgctgcccgcagcgcacgcgatagcccagggcgcggcacgaccgacgcccacgtcg
cgccacggcgaggtggcatggacgctcgcgccagggcaatgggaggcgtggtgcgacgcg
gcgcgtcgcgcgggggtgacgccgggcgccttgtgtcagggcgcgtgggcgatgctgctg
gcgcgtcacgcgggtttgcgcgacgtggtgttcggcgtgacggcctcgggacgctcggcg
gccgtgcccggcatcgaacggatggcgggattgtttatcaacaccttgcccgtgcgcgcc
aaactcgaagcgcaccgcacggtcgcgcagtggttgcgagcgttgcagacgcagacggcg
caatcgcgagaccacgagcatgtggcgctgtcagcgatcacccgcgaagcgcaacgcgaa
ggcgagggcgccgacggcgcattgttcgagagcatcgtcgtcttcgagaattatccgctc
gacgcggcactcctcggccagcgcgccgacggcctgcgtctgtcgttactggaacgtgag
ccgcaagcgcgcaacaactatccgctctcgctcatcgtcgagcagcacgacggtctgcgc
ctcgtgctcgccttcgctcgcgagcggttcgacgaggctgccgtgcgcatgctcggcgag
cagttcgtcgcgttgctcggcgcgttggcgtcaggcatcgatggcccgttggcgcgcatc
gggttgggcgacagcgttgcgcagacgacggatgccgtggtctggccgacgctggatttg
ctggatgtgtgggaggcgcacgtggcgcgtgacggccacgcgctggctgccgagggcgag
gatggcgctttgcggcgtgccgaactcgatgggttggcgaatcgtctggcagcggcgctt
caggcgcgtggcatcggaccggaggatcgtgtcgccgtttgcctgccgcgcagtgccgca
tgggtcggcgcgattctgggcatctggaaggcgggagccgcctacgttccgctcgatccc
gcgcagcccgtcgagcgtcttgaccggctcgtgaacgccagcggtgcgaaggccgtgatc
gtcgacgagcacgcacccgcaatcacgcagtcgccgacgatccgctggcatgcgctgacg
tcgactgcgcccccggatggctcggccacgcccaggcccgtacgaactcatgcgtcgcaa
gccgcctacgtcatctacacttcgggatcgacgggcgaaccgaagggtgtcgtggtcagt
cggggtgcgttgcacaactacgtgcaagccgtggcaacgcgtttgtccgagagcggtccg
gatgctggcgatcggccggcgggcggtttcgccatggcgtcgaccgtggctgccgatctg
gggcacacgacgctgttcggcgcactggcgctgggacgtccgctctatctcgtgccgcag
gcgtgcgcgttcgatgcgcaacgatttgcgcaatggtgcgccgcgcgtcccatcgacgtg
ctcaagatcgtgccgggccatctgaaaggtctgctcgacgcggcgggcgaatcggtattg
ccacgcgccgttctggtaacgggcggcgagtcgctcgatccggacttcgttggacatatt
cgggcagcgcgcccctcgctggcggtgctcaaccactatgggccgacggagacgaccgtc
ggcgcattgacgtatgcgttgccgcagggcgcgttgacgacgtcggtgccggtcggatat
ccgctggccaaccttcatgcgtacctgctcgacaccgacctcaacccggtgccgcccggt
gttgccggcgagctctatctcggtggggcggggcttgcacgaggctatctcggggcgccg
gggcagaccgccgagcgtttcgtgccggacccctggcgcgccggggggcgactgtatcgc
accggcgaccgggcagtgcaacgtgccgatggcgcgtatgtctatctcggccgcatggac
gatcaggtcaagattcgcggctatcgcgtggaacccgccgaagtggcacaggcgatgcgt
cgggtgccgggggtgacggacgcagtcgtggtggcgcgtcatgacgggccggggggcgcg
tggttgcacggtgtctatacgggcggggcgtcggccgacgtcgtacgcgcggcgctgagc
gcggcgttaccggccgcgtgggttcccgcgcgactcgatggcgtcgaccgattgcccctc
accgcgaacggcaaggtggatcgtcgcgcgctggccgcgctcggcgatccaggcgaagcc
acgaccgaattaccgcacgacggcacggaagccgagatcgcttcgatctggtgtcaggtc
ctcaaacgcgatcgggtgggacgccacgacgctttcttcgacatcggcggtgactccatt
cttgcgctgcaagtcattgcccgtctgcgcaagcgcggcctcaaggtcggtccgcagcac
ctggcgtcgcatccgacgattgccagactcgcgacgctggccgcgccggtccccgctgca
gcgtcgtctgacgcgacgcccgttcaggtcgggtcgccgggccccacacgcggcgatgcg
catcgcacccgattcccgttgtcgtcgtcgcagcgccgcgtttggctggagacgcaattg
gcgccacgtgagggcgcgtatcacatcgccggtgcgctgcgtctggaagggccattgcag
gcgcatgcgctggaacgcgcgctgcacacgctgtcggaatggcacgacgccttgcgcacc
actatcgtggtcaacgatgtcgacggcgcgccgcagcagtgcgtacatgccacgctgccg
gtcgcgttcactcgcgacgccgacattcccccgggcgccggcgacgccgccgtccaggcg
cgtctcgatgccctcacgcgggcgccgttcgatctggtggccgggccgctctggcgcgtg
catctgatgccgctgggccagcactcgcatgcgctgatgctagtcatgcatcacctgatc
tcggacggctggtcgatgaacctgttgattcgcgatctggcacacgcctatcgcgcccat
gcgagtggcgtgtcgccagcgcgcgcgtcggtgggcgccccggcaccgcaggtgcgctac
ggcgattacgcggtgtggcagcgtgagcaactggcgagtcccgcgcaggcggagcaactg
gcgtactggcgtgcgcaactcggcacgacacaccccgaattggcgctgccgttcgatcgg
gcacgcccggcgacgcgtgacggcgcgggggcgagcatcgacctgacggtatcgcccgac
ttgcctgcgcggctggaccgcttcgcgcgcgagcacggcgtgacgcgcttcatggtcatg
gccgccgcgttccatctgctcttgcatcgcgtcaccggcgacatggacatccgaacgggc
ctgccggtcgccgggcgctcgcacgagtcggtcgagccggtggtgggctttttcgtcaat
acacaggtgctgcgctcgcagatcgatacgcccacgacgtttgcgtcgctcgtcgcgcag
attcgcgatgggttgctggcggcgcaacagcatgcggatgtgccgttcgagcggttggtg
gagcatctcgcaccggtgcgcagcgtttcgcgtcatccgctgttccaggtgtcgctcaat
caccagaagcgcgccttcgccccattgagcgatctggcgggcctgacgatgcgggccatc
gagcgtcgcgcgcatcacgtgcaggtcgatctcgcgctggacaccgaggaggacgacgcc
ggcgcgttgcgcggctggctgacgtatgcctgcgatgtcttcgacgcggcgacggtgcgc
cgcctgggcgaccagtggctggcgctgctcgacgtggccatggcacaggcgcaagtgcct
gtggcgcgtctggccatgtgcgggcacgacgccgcgccgccgtcccgtcgccacccgcgc
acgagggtggccgtgccgatgccggtccatctggccatcgacgcgcaggccgcagcgcat
ggcgatgccattgccgtgaacgacggccaatcgcaattgacctacgccgaactcgtatcg
cgcgccaatcgcgtcgcccatgcgctgatccgcgcgggggttgccccggaagcgcgtgtc
gggctggctatgtcgcgtggcacggacctgatcgtcgcgatgctcggcatcctcaaggcc
ggggcggcttatgtgccgctcgatccggcctatccggcggaccggctgtgttacatggtg
gcggacgccggcgtcacccatgcaatcacgcaggcgtcgctgatgcacgccccatggctg
ccgtcgggcgcgcagacgatcgagtcgttgcttacggacgacacgctgcctgtgtgcgcg
ccggcccgtgaagtccacgtcgatcagctggcttacgtgatctacacgtcgggttcgacg
ggccgccccaagggggcgcaactcacccatcggaacctgatgcagctgctgctcggcaca
tctcgcgactttgcgttcgatgctgatgacgtctggacgatgttccacacgtacgcgttc
gacttctccgtctgggagatcttcggtgcgctggtgcacggcgcgcggctggtcgtcgtc
tcgcacgacacggcgcgcgatccggtcgcgatgtggtcgctcgtccgccgggagggcgtg
acggtgctcaaccagaccccctcggcgttctaccaatggctcggcgccatgcccgacgac
gtggtcacgacgaccttgcgccatgtcgtcttcggcggcgaagcgctcaccccggcgcgg
cttgctgcgtggtggcaacgctttggcgacgcgacgcgcctgaccaacatgtacggcatc
accgagacgacggtgcacgtgagtcggcgcgtattgcgggccgaggacaccgccggctcc
cccatcggcgagccgattgccgacctcgactggcgtgtgctcgacgcgggtctgaacgac
gtgccgccgggtgtcgcgggtgacttgtacgtgtgtggcgagggactggcgcgcggttat
ctcgggcaggcggggcttacggccgagcgcttcgtaccggacccctacggcgcgcccggc
gagcgcatgtaccgcagtggggaccgcgcgcgacgtcttgtcgacggcacgctcgattac
ctcggtcgcggcgacgcgcaggtcaagttgcgcggcttccgtatcgaacccggcgagatc
gaggcacacctgctgcgccacgacgacgtgaccgatgcggccgtcgtcgtgcgcgacgac
ggtgcgggcgagcaactggtggcgtacgtggtgtcgccagtggacgcgtccgagctatgg
ccgcgcctgcgcagtcacctcgaaggacagttgccgacgtacatggcgccgggcctgtgg
atgcgtctggacacgctgccgctcacgcccaacggcaagctcgatcgccgagcgctgccg
gtgccggaagccgtcggtgcgacgtgtttcgaggatccgcacgagggcagcgaacaactc
gttgcctcgatctggcaggacgtactgggtgtgccgcgtgtcagtcgccacgacgacttt
ttcgtgctgggcggccactccctgcttgccacgcaggtcgtgtcgcgtctgcgagacgcg
ctgtcgctcgatgtgccgctgcgcacactgttcgaagccagccgcctgagcgcgctcgcc
gaaacgctggacgcgctggtggcgcaggcacggacatcggcgtcgcatcccgacatcaac
gctgcggcggacctcacagacgccaccgatggcgcgctgcaagccgccctgcgcgaaatg
gaatccctttcccccgaggcgctgcaggcgctgctcggttcggaggcacgatag

DBGET integrated database retrieval system