KEGG   Pseudomonas veronii: PverR02_06410Help
Entry
PverR02_06410     CDS       T04853                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pvr  Pseudomonas veronii
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pvr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PverR02_06410
  Energy metabolism
   00680 Methane metabolism
    PverR02_06410
Enzymes [BR:pvr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PverR02_06410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1432164..1434809
Genome map
AA seq 881 aa AA seqDB search
MSDIDARLREDVHLLGELLGNTIREQYGDDFLDKIEQIRKGAKADRRGAVADQAAGEELS
ASLNQLQENELLPVARAFNQFLNLANIAEQYQLIHRRDESQPAPFESRVLPELLARLQRE
GHSNESLARQLGRLEIELVLTAHPTEVARRTLIQKYDAIAAQLALKDHRDLTTAEREQIR
ERLQRLIAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWQAIPNYLRKADHALQTATGLR
LPLEAAPIRFASWMGGDRDGNPNVTAPVTREVLLLARWMAADLYLRDIDQLASELSMQQA
SPALQVKVGDSVEPYRVLLKQLRDRLRATRQWAQAALSAAIPAPADVLQHNRDLLDPLEL
CYQSLHECGMGVIADGPLLDCLRRAVTFGLFLVRLDVRQDASRHTAAMTEITDYLGLGRY
EDWNEEMRIGFLMKELVNRRPLLPGYFKPSADTAEVLNTCREIAAAPAASLGSYVISMAG
AASDVLAVQLLLKESGVQRPMRVAPLFETLADLDNAGPVIEKLLLLPGYRARLQGPQEVM
IGYSDSAKDAGTTAAAWAQYRAQERLVDICREQQVELLLFHGRGGTVGRGGGPAHAAILS
QPPGSVAGRFRTTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLLPPPPPQPNWRHLMD
ELAADGVSAYRAVVRENPQFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIF
GWTQTRLMLPAWLGWEAALSKALERGEGELLGQMREQWPFFRTRIDMLEMVLAKADADIA
RLYDERLVQPELLPLGAHLRDLLSQACQVVLGLTGQSQLLAHSPDTLEFIRLRNTYLDPL
HLLQAELLARSRRQEAAQDSPLEQALLVSVAGIAAGLRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatatcgatgcacgcttgcgtgaggatgttcacctgctgggtgaactgttgggc
aacaccattcgagagcagtacggcgatgattttctcgacaagatcgagcagatccgcaaa
ggcgccaaggctgaccggcgtggcgcggtggccgatcaggcggcgggcgaggaactcagc
gccagtctgaaccaactgcaggaaaacgaactgttgccggtcgcccgggccttcaaccag
ttcctcaacctggccaacatcgccgagcagtatcagttgattcatcggcgcgatgagtcg
caaccggcgcctttcgaatcgcgggtgttgccggagttgttggcgcgcctgcaacgcgaa
ggccacagcaatgaatccctggcccgtcagttggggcgcctggagatcgagctggttctc
accgcgcaccccaccgaagtggcccgtcgcaccctgatccagaaatacgacgcgattgcc
gcgcaactggcgctgaaggatcaccgtgacctcaccaccgccgagcgcgaacagatccgc
gagcgcctgcaacggctgatcgccgaggcctggcacaccgaggaaatccgccgtacccgg
cccacgcccgtggatgaagccaaatggggcttcgcggtgatcgagcactcgttatggcag
gcgatcccgaattacctgcgcaaggccgaccatgcgttgcagaccgccaccggcctgcgc
ctgcctttggaagcggcgccgattcgcttcgcctcgtggatgggcggcgaccgtgacggc
aacccgaatgtcaccgcgccggtcacccgcgaagtcttgctgctggcgcgctggatggcg
gccgatctgtacttgcgcgatatcgatcagttggcctcggagctgtcgatgcagcaggcc
agcccggcgttgcaggtcaaggtcggcgacagcgtcgagccgtatcgcgtactgctcaag
caactgcgtgatcgcctgcgggcgacccgccaatgggcccaagccgcattgagcgcggcc
atcccggcaccggcggatgtgctgcaacacaaccgcgacctgctggacccgctggagctg
tgctaccagtcgctgcatgagtgcggcatgggcgtgatcgccgatggtccgttgctcgat
tgcctgcgccgcgccgtcacctttggcctgttcctggtgcgcctggatgtgcgccaggac
gccagccgccacaccgcggcgatgaccgaaatcaccgattacctcggtctggggcgttac
gaagactggaacgaagagatgcgtatcggcttcctgatgaaggaactggtcaatcgtcga
ccgctgctaccgggctatttcaagccgtcggcggataccgccgaggtgttgaacacctgc
cgtgaaatcgccgccgccccggctgcgtccctgggttcgtatgtcatttccatggccggc
gccgcgtcggatgtgctggcggtgcaactgttgctcaaagagtcgggcgtgcaacggccg
atgcgcgtggcgccgctgttcgaaaccctggccgacctggacaacgccggcccggtgatc
gaaaaactgttgctgctgccgggttaccgcgcacggctgcaaggcccgcaggaagtgatg
atcggctactcggactcggccaaggacgccggcaccaccgccgccgcctgggcgcagtac
cgggcgcaggaacgtctggtggatatctgtcgcgagcaacaggtggaactgctgttgttc
catggtcgcggcggcaccgtcggacgaggcggcggcccggcccacgcggcgattctgtcg
caaccgccgggctcggtggcggggcggttccgcaccactgaacaaggcgaaatgatccgc
ttcaaattcggcctgccggacatcgccgagcagaacctcaatctgtacctggcggcggtg
ttggaagcgacgttgttgccgccgccaccaccgcagccgaactggcgccatttgatggat
gaattggcagcggacggcgtcagcgcctaccgcgcggtggtgcgggaaaatccgcaattc
gtcgagtatttccgccagtccaccccggagcaggagctggggcgcctgcccttgggcagt
cgcccggccaaacgccgtgccggtggtattgaaagcctgcgggcgatcccgtggatcttc
ggctggacccagacccgcctgatgctgcccgcctggctcggctgggaagcggcgttgagc
aaggcgctggagcgcggggaaggcgagttgctggggcagatgcgcgagcaatggccgttc
ttccgcacccgcatcgatatgctggaaatggtgctggccaaggccgatgccgatatcgcg
cggctctatgacgagcgcctggtgcagcccgagctgttgccgttgggcgcgcatttacgc
gacctattgtcgcaggcctgccaggtggtgcttggcctgactggccagtcgcaactgctg
gcccatagcccggacaccctggagttcatccgcctgcgcaacacctacctcgaccccttg
cacctgttgcaggccgaattgctggcgcgctcgcgtcgccaggaagcggcacaggacagc
cctctggaacaggcgttgctggtgtccgtggccggtatcgccgccggcttgcgcaataca
ggctga

DBGET integrated database retrieval system