KEGG   Pseudomonas veronii: PverR02_22330Help
Entry
PverR02_22330     CDS       T04853                                 

Definition
(GenBank) non-ribosomal peptide synthase/polyketide synthase
Organism
pvr  Pseudomonas veronii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4929281..4942177)
Genome map
AA seq 4298 aa AA seqDB search
MMDAFELPRTLAQSLQRRAAQTPERIALRFLAESAEHNVVLSYRDLDRRARAIAAALQAN
ADLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARHHHQARLLSIIADAEPRLL
LTIASLGDDLAQIENAPPLLAVDTLDSALAERWVATDVQADDIAFLQYTSGSTALPKGVQ
VSHGNLVANELLIRRGFGIDLNPDDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLMSPAY
FLGRPLRWLEAISEYGGTISGGPDFAYRLCSDRVSESALERLDLKRWRVAYSGSEPIRLD
TLERFAEKFAPCGFTANNFFASYGLAEATLFVAGGRRGHGIPALRLDAQALAANRAEPGQ
GAAIMSCGTHQPDHAVLIADPHTLSELPDNCVGELWASGPSIAHGYWRNPEASAKTFVQH
AGRTWLRSGDLGFIREGEVYITGRLKDLLIVRGHNLYPQDIEQTIEREVEVVRKGRVAAF
AVNEQGQEGIGIAAEISRSVQKILAPQALITAIRQAVAEAYQEAPCVVVLLNPGALPKTS
SGKLQRSACALRYADGSLDSYAQFPGLQGAASDVALASTLQTQIAAIWCEQLQVATVAAD
DHFFLLGGNSISATQVVARLRETLGLELNLRLLFEAPTLSAFAADVAQLQQDGGVAQGTI
QCLSHEDELPQSLAQNRLWITWQLDPQSHAYTIPGALRLRGELDADAVRASFAHLIQRHP
ALRTRFYERDGQAFQRVLASSAFDLHVIDLGDLPAAAREARAQQIREEQAHTAFDLENGP
LLRVSLVRLDDEDHQLLVTLHHIIADGWSLNILIDEFSRLYAAASQGQPLQLPPLAVQYA
DYGNWQRQWLAEGEGQRQLAYWKAQLGDEHPALSLATDHPRAARQRNSASRHSVRLGASL
SAAIRQTAQANQSTPFMLLLAAFQTLLYRYSGQRDIRIGVPSANRPRQETQGLVGFFINT
LVLRAELDGRLPFNQLLAATRQAAVGAQAHQDLPFEQLLEAFPHAREQGLFQVMFNHQQR
DLGALRRLPGLLAEELAWHSREAKFDLQLHSEEDRNGRLSLAFDYADELFESTTIQRLAE
HFINLLHAVCEQPQRALGDLKLMQHDEQRPWSEAPCAPARQWLPEQLNQHTSDRTALVWQ
GGSLSFAQLHTQANRLAHYLRDKGVGPDVCVAIAAERSPQLLIGLLAIIKAGGAYVPLDP
DYPAERLAYMLKDSGVHLLLTQTALLAQLPTAEDVCVIAMDSLHLDRWPTQPPGLHLDGE
HLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALNDSDVLLQKAPISFDVSVWECF
WPLITGCRLVLAGPGEQRDPQRIAQLVQAHGVTTLHFVPPLLQLFIDEPLAAECTSLRRL
FCGGEALPAELRDRVLARLPAVQLHNRYGPTETAINVTHWHCRAEDGERSPIGRPLGNVI
CRVLDEQLNPLPAGVPGELCIGGIGLARGYLGRAGLTAERFVADPLGAPGSRLYRSGDRA
RWSADGVLDYLGRLDQQVKLRGFRVEPQEIEARLLALDGIAQAVVLVRDDQLIGYYTATA
ALDAQTVKAALAAGLPEYMVPAHLMRLDAMPLSPSGKLDRRALPEPVWQTREHVEPESPL
QQQIAAIWREVLGLPRIGLRDDFFALGGHSLLATQIISRTRQACDVELPLRTLFEASELG
AFAEQVGQIQAAGQRNQQTAIAQVDRSRPVPLSYSQQRMWFLWQLEPDSPAYNVGGMARL
RGVLDVGRFEAALQALVMRHETLRTTFPSVDGVAHQQVSAQTGLRMGWQDFSALSHLECE
QRLQQLADVEAHTPFNLETGPLLRVCLVKAGAQEHYLVLTLHHIVTEGWAMDIFARELSA
LYEAFIDERDSPLAPLPVQYLDYSVWQRQWLESGERQRQLDYWIAQLGYEHPLLELPGDR
PRPPVQSHRGGLYRFDLSDELAARVRAFNAAHGLTLFMSMTATLAVLLYRYSGQTDLRIG
APVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELFEQVRHTVIEGQSHQDLPFDHLV
EALQPPRSAAYNPLFQVMCNVQRWEFQQRRQLGGMSVEYLANDARATKFDLNLEVTDLDH
RLGCCLTYSTDLFDEPRVARMAEHWRNLLEALIADPQQRLSELPMLGADEQHALQRSLGS
DAAEQRLDQCLHSLFNQQALARADAPALTFAGETLSYRELNARANRLAWMLRERGVGPQV
RVGLALPRSLEMVIGLLAILKAGGAYVPLDPEYPLDRLHYMIEDSGIGLLLSDAAMFAAL
GELPATLACWCLEDDLPVLANYPASEPPFLSLPQHPAYLIYTSGSTGKPKGVVVCHGEIA
MHCQAVIERFGMRPDDCELHFYSINFDAATERLLVPLLSGAQLVLRAQGQWDAEQICGLI
RTHRINVLGFTPSYGSQLAQWLATQRQTLPVRLCITGGEALTGEHLQRIRAAFQPQVFFN
AYGPTETVVMPLAGLAPQHLAEGVGSVPIGSIVGARVAYILDADLALVPQGASGELYVGG
AGLAQGYHQRPGMTAERFVADPFAAHGGRLYRTGDLVRQLSDGQVEYLGRIDHQVKIRGF
RIELGEIETRLLEHPAVREAVVLALDSPSGKQLVAYLASDAEHGPLRDALKAHLKAQLPD
YMVPAHWLVLDSMPLTANGKLDRRALPPPDAEANRQHYVAPRNALEQALAAIWCAVLNVQ
QVGLDDNFFELGGDSILSIQVVSRARQAGIHFSPRDLFQHQTVQTLAAVATRAEQVSAEQ
GVLSGRSGLTPIQQWFFETEIPARQHWNQALVLKPLQLLDPHRLEQALLAVLEQHDALRL
SFTRRDAQWHAEHLAVPEGGVLMQAQVCDLQQCSALFSDTQRSLDLAHGPLLRALLVDGP
QGQQRLLIVIHHLVVDGVSWRVLLEDLQNVYRQLSDGQSVSLPAKTSALRDWAARLQAYA
GSESLREELCVWQERLAGAAVPLPVARPHGALRHRDAETLSVRLDAERTRQLLQQAPSAY
RTQVNDLLLTALARVLCRWSGHASALIQLEGHGRETLFDEIDLTRSVGWFTSAYPVRLTP
LAEQGASIKAIKEQLRGVPHKGLGYGVLRYLADDVCKQTMAALPSADITFNYLGQFDQSF
GADALFHPLEESAGLAHDPDAPLPNELSVDSQVYGGELVLRWTFSRARHDQQTIGDLAAA
YLDELHSLIAHCLKDGAGGLTPSDFPLARLTQAQLDALPVPASAIEDVYPLTPMQEGLLL
HTLLEPGTGLYYMQDRYRIDSALDPERFAQAWQAVIARHEALRASFCWNVGEDMLQVIHK
PGSTPIEYLDWRAVAEAEQEPRLQALLKAEREAGFDLLNQAPFHLRLIRVAEARYWFMMS
NHHILIDAWCRSLLMNDFFDLYTALGAGHDAQLATPPRYRDYIAWLQRQNLSAARQWWQH
NLRGFERTTPIPSDRPFLREHAGGSGGMVVGDCYTRLDARDGIHLRELAQAHQLTVNTFA
QAAWALVLRRLSGERDVLFGVTVAGRPVDMPDMQRTVGLFINSIALRVKLPEEGQQCSVR
HWLNGLLDSNMQLREYEYLPLVTLQEHSELPKGQPLFDSLFVFENAPVEVSVLDRAQSLN
ATSDSGRTHTNFPLTAVCYPGDELGLHLSYDQRYFDESTVQGMLSEFKRLLLALMQGFHG
DMAELPLMGAQEREFLVHGCNRSEHAYPLERSYIELFEAQVAQHPQRIVATCLDRQWTYA
ELNRRSNGLGHALIAAGVGLDQPVALLAERSLDLLGMIIGSFKAGAGYLPLDPGLPGQRL
SRIIELSRTPLLVCTEACREQAIELLQGVECQLLVWEEVPARGANPGIYSGPDNLAYVIY
TSGSTGQPKGVMVEQRGMLNNQLSKVPYLDLSPVDVIAQTASQSFDISVWQFLAAPLFGA
RVDIVPNAVAHDPQGLLAHVQAQGISVLESVPSLIQGMLAEARIRLDGLRWMLPTGEAMP
PELAQQWLLRYPEIGLVNAYGPAECSDDVAFFRVDLASTRGTYLPIGAPTDNNRLYVLDA
ALALVPQGAVGELCVAGTGVGRGYVSDPLRTAQVFVPNPFGAAGERLYRSGDLARRRSDG
VLEYVGRIDHQVKIRGYRIELGEIEARLHEQAAVRDAAVGVQEGVNGKHLVGYLVAADTT
LDPGECLERIKQRLRAELPEYMVPLHWLWLERLPLNANGKLDRNALPALEIGQLHDQAYL
APRTALEGTLAAIWAEVLKVDRVGVQDNFFELGGHSLLATQIASRVQKTLQRDVPLRAMF
ECSTVAQLAEYIDGLAATAISAEKVDRLSDLMAELEGL
NT seq 12897 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttccccgcaccctggcccagtcccttcaacgccgcgccgcg
cagactccggagcggatcgctctgcgtttcctcgctgagtccgccgaacacaacgtggtc
ctcagctaccgcgacctcgaccgacgcgcccgtgccatcgccgccgccctgcaggccaac
gccgacctgggcgaccgtgccgtattgttgttccccagcgggccggactatgtggcggcg
ttcttcggttgcctgtacgccggggtgatcgcggtgccggcctatccgccggagtccgct
cgtcaccatcaccaggcgcgcttgctgtcgatcatcgccgacgccgaaccgcgcctgttg
ctgaccatcgccagcctcggcgatgacttggcgcagatcgaaaacgcgccgccgctgctg
gcggtcgacaccctcgacagcgcgcttgccgagcgctgggtcgccaccgatgtacaagcc
gacgacatcgccttcctgcaatacacctcgggctccaccgccttgcccaagggtgtgcag
gtcagccacggcaatctggtcgccaatgaactgctgatccggcgcggtttcggcatcgac
ctgaacccggatgacgtgatcgtcagctggctgccgctgtaccacgacatgggcctgatc
ggcggcctgctgcaaccgatcttcagcggcgtgccctgcgtattgatgtcgccggcgtac
ttcctcggccggcccttgcgctggctggaagcgatcagcgaatacggcggcaccatcagc
ggcggcccggatttcgcctaccgcttgtgcagcgaccgggtcagcgaatcggccctggaa
cgcctggatttgaagcgctggcgcgtggcgtattccggctccgaaccgatccgcctcgac
accctggaacgcttcgccgagaagttcgccccgtgcggtttcaccgcgaacaacttcttc
gcctcctacggcctggccgaagcaaccctgtttgtcgccggcggccgccgtggccacggc
atcccggccctgcgcctggatgcccaggcgctggccgccaaccgcgccgagccggggcag
ggcgcggcgatcatgagttgcggtacacatcagccggaccacgcggtgctgatcgccgat
ccccacaccttgagcgaactgcctgacaactgcgtcggcgaactctgggccagcggcccg
agcattgcccacggctactggcgcaaccccgaagccagcgccaagaccttcgtccagcac
gccggccgcacctggctgcgcagcggcgacctgggctttatccgcgagggcgaggtgtac
atcaccgggcgcttgaaagacctgctgatcgtgcgcggccacaacctctacccgcaggac
atcgagcagaccatcgagcgcgaagtggaggtggtgcgcaaaggccgggttgcggcgttc
gcggtgaatgagcagggccaggaaggcatcggtatcgccgctgagatcagccgcagcgtg
cagaaaatcctcgcgccgcaagcgctgatcacggcgatccgccaagccgtggccgaagcc
tatcaagaggcgccgtgcgtggtggtgttgctcaaccccggcgcgttgccgaagacctcc
agcggcaagctgcagcgttcggcatgtgcgttgcgttacgccgatggcagcctcgacagc
tatgcgcagttccccggtctgcaaggcgcggccagtgatgtcgcgctggcgtccaccttg
cagacccagatcgcggcgatctggtgcgagcagttgcaggtggcgacggtagcggcggat
gaccacttcttcctgctcggcggcaattccatcagcgcgacccaagtggttgcgcgcctg
cgcgaaaccctgggcctggaactgaacctgcgcctgctgttcgaagcgccgaccttgtcg
gccttcgctgccgatgtggcacagttgcagcaggatggcggcgtcgcccaaggcacgatc
cagtgcttgtcgcatgaggatgaactgccgcaatccctcgcacagaatcgcctgtggatc
acctggcaactcgacccgcagagccacgcgtacaccatccccggtgccctgcgcctgcgc
ggcgagctggatgcagacgcggtgcgcgccagcttcgcgcacctgatccagcgccaccca
gccctgcgcacgcgcttctacgaacgggatgggcaagccttccaacgggtgttggccagc
agcgcattcgacttgcacgtcatcgaccttggtgacctgcccgccgccgcgcgcgaagcc
cgtgcgcagcagatccgcgaggagcaggcgcacaccgcgttcgacctggaaaacggcccg
ttgctgcgggtgagcctggtgcgcctggacgacgaagaccatcagttgctggtgacgctg
catcacatcatcgccgacggctggtcgctgaatatcctcatcgatgagttctcgcgcctg
tacgccgcggcgtcccagggccagcccctgcaactgccgccactggccgtgcaatacgcc
gactacggcaactggcagcgccaatggttggccgagggcgaaggccagcggcaactggcg
tactggaaggcgcagttgggagacgaacacccagccttgagcctggccaccgatcacccg
cgtgcagcgcggcaacgcaacagtgcttcgcgccacagcgtgcgtctgggcgcaagcctc
agcgcggcgattcgccagactgcccaggccaaccaatcgacgccgttcatgctgttgctc
gcggcgttccagaccttgctctaccgctacagcggccagcgcgacatccgcatcggcgtg
cccagcgccaaccgcccgcgccaggaaacccaaggcctggtcggcttctttatcaacacc
ctggtactgcgcgccgagctggacgggcgcctgccgttcaaccagctgttggcggccacg
cgccaggcggcagtgggcgcccaggcccatcaggatctgcccttcgaacaactgctcgaa
gcgttcccccacgcccgtgaacagggcctgttccaggtgatgttcaaccatcagcagcgc
gacctcggcgctttgcgtcgcctgccgggcctgctcgccgaagaactggcgtggcacagc
cgcgaagccaagttcgacctgcaattgcacagcgaagaagaccgcaacgggcgcctgagc
ctggcgttcgactacgccgacgaattgttcgaaagcaccaccatccaacgcctggccgag
cacttcatcaacctgctgcacgccgtgtgcgagcaaccgcagcgggccctcggcgacctc
aaattgatgcaacacgacgaacagcggccctggagcgaagcgccttgcgcgccggcccgg
caatggttgcccgaacagctcaaccaacacacctcggaccgcaccgcgctggtctggcag
ggcggcagcctgagctttgcccaactgcacacccaggccaaccgcctggcccattacctg
cgcgacaagggcgtcggccccgacgtgtgcgtggccatcgccgccgagcgttcgccgcaa
ctgttgatcggcctgctggcgatcatcaaggccggcggcgcctacgtgccgctggacccg
gattaccccgccgagcgcctggcctacatgctcaaggacagtggcgtccacctgctgctg
acccagaccgcgttgctggcgcaattacccacggccgaagacgtgtgcgtgatcgccatg
gacagcctgcacctcgaccgctggccgacccagccgccgggcctgcatctggacggcgag
cacctcgcctacgtgatctacacctccggctccaccggccagcccaagggcgtgggcaac
actcatgcggccctggccgagcgcttgcagtggatgcaggccacctacgcgctgaatgac
agcgacgtgctgctgcaaaaagccccgatcagtttcgacgtgtcggtgtgggagtgcttc
tggccgctgatcaccggctgccgcctggtgttggcggggccgggcgagcagcgcgacccg
cagcgcatcgcgcaactggtgcaggcccatggcgtgaccactctgcactttgtgccgccg
ctgttgcagctgtttatcgacgagccgttggcggccgaatgcaccagcctgcgccgtctg
ttctgcggcggcgaagccttgcccgccgagttgcgtgaccgtgtgcttgcgcggttgccg
gcggtgcagttgcacaaccgttatggcccgaccgaaaccgcgatcaacgtcacccattgg
cactgccgcgccgaggatggcgagcgttcgccgattggccgaccgttgggcaatgtgatc
tgccgcgtgctcgacgagcagctcaacccgttgccggcgggggtgccgggcgagctgtgc
atcggcggcatcggcctggcacgcggttacctcggccgcgccgggcttactgccgagcgt
tttgtcgccgaccccttgggcgcgccgggcagccgtctgtatcgcagcggtgaccgcgca
cgctggagcgctgacggcgtgctcgactacctcggtcgtctcgatcagcaggtcaagttg
cgcggctttcgcgtcgaaccgcaagaaatcgaagcgcgcctgctggccctcgacggtatc
gcccaggccgtggtgctggtgcgcgatgatcaattgatcggctattacaccgccactgcc
gcgctcgacgcccaaaccgtcaaagccgccctggccgccgggttgccggaatacatggtg
cccgcgcacctgatgcgcctggacgccatgcccctgagcccgagcggcaagctggaccgc
cgtgcgctgcccgagccggtgtggcaaacccgcgaacatgttgaacccgagagcccgttg
cagcagcagattgcggcgatctggcgcgaagtgctgggcctgccgcggatcggcctgcgc
gatgattttttcgccctcggcggccattcgttgctggccacgcaaatcatctcgcgcacc
cgccaggcgtgtgacgtcgagctgccgttgcgcaccctgttcgaagccagcgaactcggc
gcgtttgccgagcaggtcgggcagatccaggccgccggccaacgcaaccaacagaccgcc
atcgcccaggtcgaccgcagccggccggtgccgctgtcctattcccagcagcggatgtgg
ttcctctggcagttggagccggacagcccggcgtacaacgtcggcggcatggcgcgtttg
cgcggggtgctcgacgtggggcgtttcgaggccgcgttgcaggccttggtcatgcgtcac
gaaaccctgcggaccaccttcccgagcgtcgatggcgtggcccatcagcaggtgtcggcg
cagaccggcctgcgcatgggctggcaggacttctcggcgctgagccacctcgaatgcgag
caacgcttgcagcagctggccgatgtcgaggcgcacacgccgttcaacctggaaaccggg
ccgctgttgcgcgtgtgcctggtcaaggccggcgcgcaggaacattacctggtgctgacc
ttgcaccatatcgtcaccgaaggttgggccatggacatctttgcccgtgaactcagcgcg
ctgtacgaagccttcatcgatgagcgcgactcgccgctggcgccgctgccggtgcagtac
ctcgactacagcgtgtggcagcgccagtggctggagtccggcgagcgccagcgccagctc
gattactggatcgcgcaattgggttatgagcatccgctgctggaactgcccggcgaccgc
ccgcggccgccggtgcaaagccaccgcggcgggctgtaccgttttgatttgagcgacgaa
ctggccgcgcgcgttcgggccttcaatgctgcgcacggcctgaccctgttcatgagcatg
accgccaccctggcggtgttgctctaccgctacagcggccagaccgacctgcgcatcggc
gctccggtggccaatcggattcgcccggaaagcgaagggctgatcggcgccttcctcaac
acccaggtactgcgttgccggctcgacgggcagatgagcgtcggtgagttgttcgagcaa
gttcgtcacaccgtgatcgagggccagtctcaccaggacctgccgttcgaccatctggtg
gaagcgctgcaaccaccgcgcagcgcggcgtacaacccgctgttccaagtgatgtgcaac
gtgcagcgttgggaattccagcagcgccgccaactgggcgggatgagcgtcgagtacctg
gccaacgatgcgcgtgcgaccaagttcgacctcaacctggaagtcaccgaccttgaccat
cgcctgggatgctgcctgacctacagcaccgatttgttcgatgagccgcgcgttgcgcgc
atggccgaacattggcgcaacctgctcgaagcgctgatcgccgacccgcagcaacgcctc
agcgaactgccgatgctgggtgccgacgagcagcacgcattgcagcgcagcctggggagc
gacgcggctgaacagcgcctcgaccagtgccttcactcactgttcaaccagcaggcactg
gcccgtgccgacgcgccggcactgacgtttgccggtgagaccctcagctaccgcgaactg
aatgcccgcgccaaccgcctggcctggatgctgcgcgagcgtggcgtcggcccgcaggtg
cgcgtcggcctggcgttgccgcgctccctggaaatggtcatcggcctgctggcgattctc
aaggccggcggcgcctatgtgccgctggacccggagtacccgctggaccgcctgcattac
atgatcgaagacagcggcatcggcttgctgctcagtgatgcggcgatgttcgccgccctc
ggtgaactgccggcgacgctggcgtgctggtgcctggaagacgacctgccggtgctggcg
aactacccggccagtgagccgccgtttctcagcctgccgcaacacccggcgtacctgatc
tacacctccggctccaccggcaagccgaaaggcgtggtggtgtgccacggcgaaatcgcc
atgcactgccaggccgtgatcgagcgtttcggcatgcgcccggatgactgtgagctgcac
ttctattcgatcaacttcgacgccgccaccgagcgtttgctggtgccgttgctcagcggc
gcacaactggtattgcgcgcccagggccagtgggatgccgagcagatctgcgggctgatc
cgcacccatcgcatcaatgtgctgggcttcaccccgagctacggcagccagttggcgcaa
tggctggcgacccagcggcagaccttgccagtgcggttgtgcatcaccggcggcgaggcg
ctgaccggcgaacacctgcagcgcatccgcgcggcgttccagccgcaggtgtttttcaac
gcctacggcccgactgaaaccgtggtgatgccgctggccggcctcgcaccgcagcacttg
gcggagggcgtcggcagcgtgccgatcggcagcatcgtcggcgcccgcgtggcctatatt
ctcgacgccgacctggccctggtgccgcaaggcgcgagcggcgagttgtacgtcggcggg
gcagggctggcgcagggttatcaccagcgtccggggatgaccgcagagcgttttgtcgcg
gaccccttcgcggcccatggcggtcgcctgtaccgcaccggcgatctggtgcgccaactg
agcgatggccaggtggaatacctcgggcggatcgaccatcaggtgaagatccgtggtttc
cgcatcgaactgggcgagatcgaaacgcgcctgctcgaacatcccgccgtgcgcgaagcg
gtggtgctggcgctggattcgccgagcggcaaacagctggtggcctatctggccagcgac
gccgagcacggccccttgcgcgacgccttgaaggcgcacctcaaagcgcaactgccggac
tacatggtgcccgcccattggctcgtgctggacagcatgccgctgaccgccaacggcaag
ctcgaccgccgcgccttgccgccgccggatgccgaggcgaatcgccaacactacgtggcg
ccgcgcaacgcgctggagcaggcgttggcggcgatctggtgcgcggtgttgaacgtgcag
caggtcggtctcgacgataacttctttgaactgggcggcgattcgatcctgtcgatccag
gtggtcagccgtgcgcgccaggccgggattcacttcagcccgcgggatttgttccagcac
cagaccgtacagaccctggccgccgtcgccacgcgcgccgagcaggtcagcgccgagcaa
ggcgtgctgagcggccgctcggggctcacgccgatccagcagtggttcttcgagacagag
attcccgcgcgtcaacactggaaccaggcgctggtgctcaaaccgctgcaactgctcgat
ccccatcgcctggagcaagccctgctggcggtgctggaacagcatgacgcgctgcgcctg
agcttcacccggcgcgacgcgcaatggcacgccgaacacctggccgtgccggagggcggt
gtgctgatgcaggcgcaagtgtgtgatctgcaacagtgcagcgcgttattcagcgacacc
caacgcagcctcgacctggcccacggcccgctgttgcgcgcgttgctggtggacggcccg
caaggccagcagcgcctgctgatcgtgatccatcacctggtggtggatggtgtgtcgtgg
cgtgtgttgcttgaggatctgcaaaacgtctatcgccaattgagcgacggccaatccgtc
agcctgccggccaagaccagtgccttgcgcgactgggccgcccgcttgcaggcctatgcc
ggcagcgaatccctgcgcgaagaattgtgcgtctggcaggagcgcttggccggtgcggcg
gtgcccttgccggtggcgcgcccgcacggcgcattgcgccatcgcgatgccgagacgctc
agcgtgcgcctggacgccgaacgcacccgccagttactgcaacaggcccccagcgcttat
cgcacccaggtcaacgacctgctgctgaccgccctggcccgcgtactgtgccgctggagc
ggtcacgcctcggcgctgatccagctggaaggccacggccgcgaaaccctgttcgatgag
atcgacctgacccgcagcgtcggctggttcaccagcgcctatccggtgcgcctgacgccg
ctggcggagcagggcgcatcgatcaaagccatcaaggagcaactgcgcggcgtgccgcac
aaaggcctgggctacggcgtgctgcgctacctggcggacgacgtgtgcaaacagacgatg
gccgcactgccgagtgccgacatcaccttcaactacctcggccagttcgaccagagcttc
ggcgccgatgcactgttccacccgctggaggaatccgccggcctcgcccatgacccggat
gcgccgctgcccaacgaactgagtgtcgacagccaggtgtacggcggcgaactggtgctg
cgctggaccttcagccgcgcacgccacgatcagcagacgattggcgacttggccgcggcc
tacctggacgaactgcacagcctgatcgcccattgcctcaaggacggcgccggcggcctc
acgccttccgacttccccctggcgcgcctgacccaggcgcagttggacgccttgccggtg
cccgccagtgcgatcgaagacgtgtacccgctgaccccgatgcaggaaggcctgctgctg
cataccctgcttgaaccgggcaccggcctctactacatgcaggaccgctaccgcatcgac
agcgccctcgaccccgagcgtttcgcccaggcctggcaagcggtgatcgcccgtcacgaa
gccttgcgcgcctcgttctgctggaacgtcggcgaggacatgctgcaagtgatccacaaa
cccggcagtacgccgatcgagtacctggactggcgcgccgttgccgaggccgaacaggaa
ccgcgcctgcaagcgctgctcaaggccgagcgcgaagccggtttcgatctgctcaaccag
gcgccgttccacctgcgtctgatccgcgtcgctgaagcgcgctactggttcatgatgagc
aaccaccacatcctcatcgatgcctggtgccgttcgttgttgatgaatgacttcttcgac
ctctacacggccctcggcgcaggccacgacgcgcaactggccacgccgccgcgttatcgc
gactacatcgcctggctgcaacgccagaacctgagtgcggcgcgccagtggtggcagcac
aacctgcggggcttcgagcgcaccacgccgatccccagcgaccgcccgttcctgcgcgaa
cacgccggtggcagcggcggcatggtagtgggcgattgctacacccgcctcgatgcccgc
gacggtatacacctgcgcgaactggcccaggcccatcagctgaccgtcaacacctttgcc
caggccgcgtgggccctggtgctgcggcgcttgagcggcgagcgtgacgtgctgttcggc
gttaccgtggccgggcgtccggtggacatgccggacatgcaacggaccgtcggcctgttc
atcaacagcatcgcgctgcgtgtgaagctgcccgaggagggccaacagtgcagcgtgcgc
cactggttgaatggcctgctcgacagcaatatgcaactgcgcgagtacgaatacctgccg
ctggtgacccttcaggaacacagcgaattgcccaagggccaaccgctgttcgacagcctg
ttcgtgttcgaaaacgccccggtggaagtctcggtactcgaccgtgcgcaaagcctgaac
gccacctcggactccggccgcacccacaccaacttcccgctgacggccgtgtgctatccg
ggcgatgagcttggtttgcacctgtcctacgaccagcgttacttcgacgaaagcaccgtg
cagggcatgttgagtgagttcaagcgcctgctgctggcgctgatgcaggggtttcatggc
gacatggccgagctgccattgatgggcgcgcaggagcgtgaattcctggtacacggctgc
aaccggagcgagcacgcctacccgctggagcgcagctatatcgagctgttcgaagcccag
gtggcgcagcatccgcaacgcatcgtcgccacgtgcctcgaccgacagtggacgtatgcc
gagttgaaccggcgcagtaacggcctgggccacgcactgatcgccgcgggtgtcggcctg
gatcagccggtggcattgctggcggagcgcagtctcgatttgctcggcatgatcatcggt
agcttcaaggccggtgccggttacctgccgctcgacccggggctgcccggtcagcgtctg
agccggattatcgagctgagccgcaccccgttgctggtgtgtaccgaggcgtgtcgcgag
caggccattgagctgctgcaaggcgtggaatgccagttgctggtgtgggaggaggtgcct
gctcgtggggcgaaccccggcatttacagtggcccggacaaccttgcctatgtgatctat
acctcgggctccaccggccagcccaaaggcgtgatggtcgaacagcgcggcatgctcaac
aaccagttgagcaaggtgccgtatctggacctgagcccggtggatgtgatcgcgcaaacc
gcctcgcagagtttcgatatttcggtgtggcagttccttgccgcgccgctgttcggcgcg
cgggtggatatcgtgccgaatgccgtcgcccacgatccccagggcttgctcgcccatgtg
caggcccagggcatcagcgtgttggaaagcgtgccgtcgctgatccagggcatgctggcc
gaggcacgcatccgcctggacggcctgcgctggatgctgccgaccggtgaagccatgccg
ccggagctggcgcagcagtggttgctgcgttaccccgagattggcttggtcaacgcttat
ggtccggcggaatgttcggatgatgtggcgttcttccgtgtcgacctggcctcgacccgt
ggcacttacctgccgattggtgcgccgaccgacaacaaccgcttgtacgtgttggacgct
gcactggcgttggtgccgcagggcgcggtgggcgagctgtgcgtcgccggtaccggcgta
gggcgcggttacgtcagcgacccgctgcgcaccgcccaggtgttcgtgcccaacccgttc
ggcgccgcgggcgagcgtctgtaccgcagcggcgacctggcacggcggcgcagcgatggg
gtgctggagtacgtcgggcgtatcgaccatcaggtgaagatccgcggctaccgcatcgag
ctgggggaaatcgaagcgcgtctgcatgaacaagcggcagtgcgcgacgcggcggtcggg
gtgcaggagggcgtcaatggcaaacacctggtcggttacctggtggccgccgacaccacc
ctcgaccccggcgagtgcctggagcgcatcaaacaacgcctgcgcgccgaactgccggaa
tacatggtgccgctgcactggctgtggctcgagcgcctgccgctcaacgccaacggcaaa
ctcgaccgcaacgccctgccggccctggagatcggccagttgcacgaccaggcctacctg
gcgccgcgcacggcactggaggggacattggccgcgatttgggccgaggtgctcaaggtt
gaccgggtgggcgtgcaggacaacttcttcgaactgggcgggcactcgttgctggccacg
cagatcgcctcgcgcgtgcagaagacgttgcaacgggatgtgccgttgcgggcgatgttc
gagtgcagcacggtggcgcagttggccgagtacatcgatgggctggcggcgacagcgatc
agtgccgagaaggtggatcggttgagtgatttgatggcggagttggagggcttgtga

DBGET integrated database retrieval system