KEGG   Pogona vitticeps (central bearded dragon): 110070534Help
Entry
110070534         CDS       T05000                                 

Definition
(RefSeq) trypsin I-P38-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pvt00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110070534
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     110070534
Peptidases [BR:pvt01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   110070534
Exosome [BR:pvt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110070534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 248 aa AA seqDB search
MKFILLVAFLGAAVAFPIDDNDDDKIVGGYTCAKNSIPYQVSLNSGYHFCGGSLINSQWV
VSAAHCYKSRIQVRLGEHSLDSNDGSEQYISSSKIIRHPNFNSNTLNNDIMLIKLSSAAT
LNSNVQAISLPSSCVSAGTQCLVSGWGNTLSSGTKYPDLLQCLRAPVLSSSQCSAAYPGQ
ITSNMICVGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGKGCALKGSPGVYTKVCNYVSW
IQSTIRSN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttattttactcgtggccttcttgggagctgctgtggccttccccattgatgac
aatgatgatgacaagatcgttggcggatacacctgtgcaaagaattccatcccatatcaa
gtctctctgaattcaggataccacttctgtggtggatccctcatcaacagccagtgggtt
gtgtcagctgctcactgctacaagtcgcgtatccaagtgagacttggagaacacagtttg
gactcaaatgatggctcggagcaatacatctcctcatccaaaatcatccgtcaccctaat
ttcaactccaatacgttgaacaatgacatcatgctcatcaagctgtcttcagcagccacc
ctcaactccaatgtccaggctatctctctgccctctagctgtgttagtgctgggacacag
tgtctggtctctggttggggcaacaccctcagcagtggcactaagtaccctgacctcctc
cagtgcctgagggctccagtactttcctccagtcagtgcagtgcagcttatccggggcaa
atcaccagtaatatgatctgcgtgggatacctggaagggggcaaagactcctgtcaggga
gactctggtggaccggtggtctgcaatggggaactccaggggattgtctcctggggcaag
ggttgtgctctgaagggctctcctggcgtctacaccaaagtttgcaactacgtctcctgg
attcaaagcaccatcagatccaactga

DBGET integrated database retrieval system