KEGG   Pogona vitticeps (central bearded dragon): 110075430Help
Entry
110075430         CDS       T05000                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pvt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    110075430
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110075430
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110075430
   00430 Taurine and hypotaurine metabolism
    110075430
Enzymes [BR:pvt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     110075430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 553 aa AA seqDB search
MVIQRGKEMDFRPVTHTNEQGCTNEQKEKRKSGFQGKCEEGQNNCTIDSCVTNFSNIYES
DLLPAQNGEECTDHFLHEVVDILLSYIKKTYDRKSKVLDFHHPHQLLEGLEGFSVELSEQ
PEPLEQILVDCRDTLKYGAKTGHPRYFNQLSSGLDIVGLAGEWLTAAANTNMFTYEIAPV
FIVMEEILLQKMCEIIGWRKIEADGIFSPGGSISNLYSILVARYKHYPEIKTKGMKALPN
IVLFVSEHSHYSVKKAAAVLGIGVDNVITVKCDERGRMIPTDLARNILKVKRQGKVPLYV
CATSGTTVYGAFDPLASIADICEKYNLWMHVDAAWGGGLLLSRKHSHKLSGIERANSVTW
NPHKLMGVPLQCSAFLVREKGLLQACNQLCAGYLFQPDKQYDTSYDTGDKTIQCGRHVDV
FKLWLMWRAKGTRGFEMHINKFLELAEYLYKELKIRKNYKLVFDAEPELTNVCFWYIPPS
LQQIPKGPERQKRLHQVAPKIKARMVEEGTMMVSYQPHGDKVNFFRMVFSNLATKKSDVD
FLLDEIERLGKDL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggttattcagagaggcaaagagatggatttccgaccagttacccacacaaatgagcaa
ggctgtaccaatgagcagaaagaaaagcggaagtctggtttccagggaaaatgtgaggag
ggacaaaataattgtaccattgacagctgtgtaacaaatttctccaacatctatgagtca
gacctactccctgcccagaatggagaggaatgtacagaccatttccttcatgaagtggtg
gatattctcttgagttatatcaagaagacctatgacagaaagagcaaagtgctggatttc
caccatccccatcaacttctggaagggctggaaggcttcagtgtggaactttctgaacaa
ccggaacctttggagcagatattggttgactgtagggatactttgaaatacggagctaaa
acaggacatcctcgttatttcaaccaactctccagtggccttgacatcgtaggacttgct
ggggaatggctgacagctgcagcaaatacaaacatgtttacctacgaaatagctcctgta
tttattgtaatggaagaaatcctgcttcagaaaatgtgtgaaattattggatggagaaaa
attgaagcagatggcatattttctcctggaggcagcatatcaaatctttacagtatttta
gtagcccgttataaacattaccctgagattaaaaccaaaggcatgaaagcccttcccaac
attgtattgtttgtctctgaacatagccattactctgtaaagaaagctgctgcagttctt
gggattggggtggataacgtgattactgtcaagtgcgatgaaaggggaaggatgattcca
actgacctggcaagaaacatcctcaaagtcaaaagacagggcaaagtcccactctatgtc
tgtgccacatctgggaccacagtgtacggagcctttgatcctcttgccagcattgccgac
atttgtgagaagtacaatctctggatgcatgtagatgcagcctggggtggaggtttgcta
ctgtcaaggaagcattcccataaactgagtggcattgagcgggccaattctgtcacctgg
aatcctcacaaattaatgggagtcccactgcagtgctcggcctttttagtccgtgagaag
ggtcttctccaagcctgtaatcagctttgtgctggatacctcttccagccagacaaacag
tatgacacatcttatgacactggggacaagacaatccagtgtggccgacatgttgatgtc
ttcaaactgtggctgatgtggagagccaagggaactagaggatttgaaatgcatatcaac
aaatttctagaacttgcagaatacctttataaggaactgaaaataagaaaaaactacaag
cttgtatttgatgctgagcctgaactcaccaatgtatgtttctggtacatcccaccaagt
cttcagcagatccccaaaggaccagagagacagaaaagacttcatcaggttgctccaaag
ataaaagcaaggatggtagaagaaggaaccatgatggttagctatcaacctcatggggac
aaagtgaattttttcagaatggtcttctctaatctggcaaccaagaaatctgatgtcgat
ttcctcttggatgaaattgaacggcttgggaaggatttgtga

DBGET integrated database retrieval system