KEGG   Pogona vitticeps (central bearded dragon): 110078143Help
Entry
110078143         CDS       T05000                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: sialidase-3-like
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pvt00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    110078143
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    110078143
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     110078143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 443 aa AA seqDB search
MLGPFALKGIRTTNVSVCPENMAEAPASSPKVVLFRQKKRGGLTYRIPALLYLPSESTFL
AFAEERSSPRDEDAKFLVMRRGQKKETTVQWGPVEALETAMLPGHRTMNPCPVYDRKTGT
IFLFFIGVQTYITEGHQIRTGRNAARLCYVSSQDGGHTWSQVTDLTDQVIGDDLRNWXTF
AVGPGHGVQLTSGRLVVPAYAYYIHKRLFGRPLGCWIKPHSFTFYSDDGGRHWARGQLLK
TLRTSECQVAELTCPDNSQVLYCSARTLHKYRAGAVCVDHGDQFVNPSLCKELYEPPRGC
QGSVVSFSPMLESLDLSRQEEARKPTPRASDAQPFSASLKSAASWLIFSHPTNRRTRTDL
GIYLNTSPLDPGSWKAPWVLNPGPSGYSDLAICEEGNAQMFGCLFECGASCECEEIAFRL
FTDVELLRNVGESCSGPRSPPEA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtccgtttgcactcaaaggaatccgcaccacgaacgtttctgtatgcccagaa
aatatggccgaagctccagctagctctcccaaagtggtccttttccgccagaagaagcga
ggggggctgacctaccgcatcccagccctcctctacctgccctccgaatccaccttcctg
gcgtttgcagaggagagatcgtcaccccgagacgaagacgccaagtttctggtgatgaga
cgcgggcagaagaaggaaacaacggtccagtggggtccggtggaggcgctggagaccgcc
atgttgcccggccaccgcaccatgaacccttgcccggtttatgacagaaaaactggcacc
attttcctcttcttcattggcgtccagacctacattacagaggggcaccaaatccggacg
gggaggaacgcggccaggctgtgctacgtctccagccaagacggcggccacacctggagc
caggtgaccgacctgacagaccaggtgattggggacgacttgagaaactggnccactttt
gctgtcgggccaggccacggcgtccagttgacctccgggcggctggtggttccggcctac
gcctactacatccacaagcgtttgttcggccgccccctgggctgttggatcaagccccat
agcttcaccttctacagcgacgacggcgggagacactgggcccggggccagctcctcaaa
accttgcgcacctcggagtgccaggtggcggagctcacctgcccggacaatagccaagtc
ttgtactgcagtgcccgcaccctgcacaagtaccgggcgggcgcagtctgtgtggaccac
ggagaccaattcgtgaacccctccctgtgtaaagagctgtacgagcccccccgggggtgt
caagggagcgtggtgagtttctcccccatgctggagtccctggatctgagtcggcaggaa
gaggctcgcaaaccgactcctcgggcatcggatgcccagccgttctcggcctccctcaag
agcgccgcgtcgtggctgattttctcccaccccaccaacaggcgcacgcggacggatctg
ggcatctacttgaacacgtcccccttggatccggggtcgtggaaagccccctgggtgctg
aacccggggcccagcggctactcggacctggccatctgcgaggagggcaacgcgcagatg
ttcggctgcctgtttgagtgcggagcgtcctgcgagtgtgaagagattgcttttcggctg
ttcacggatgtcgagctcttgaggaacgtgggggaaagttgctccggcccccgttcgccc
ccagaggcgtag

DBGET integrated database retrieval system