KEGG   Pogona vitticeps (central bearded dragon): 110080291Help
Entry
110080291         CDS       T05000                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
Enzymes [BR:pvt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     110080291 (ACE)
Peptidases [BR:pvt01002]
 Metallo Peptidases
  Family M2
   110080291 (ACE)
Exosome [BR:pvt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110080291 (ACE)
CD molecules [BR:pvt04090]
 Proteins
  110080291 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1284 aa AA seqDB search
MMPPAPGVLLLLLLCLRATLALDDPLNPPNHPATEEGALLFAQDYNSTAETVFFESVSAS
WNYNTNLTDFNSQLQVAASLKEQEFIEAWGKKAKESYGHIWQNFSDPQLKHIISSIQTLG
PSNLPVVKRERYNTILSEMDNIYSTAKVCPPNQNSNCWALEPEITDIMANSRSYRKLLYA
WEGWHNSAGNPLRSKYEEFVSLSNEAYEKDGFKDTGAYWRSWYDSPTFEDDLEELYHELE
PLYLNLHAFVRRKLYELYGSTYINLKGPIPAHLLGNMWAQQWNNIYDMMVPFPNKPSLDV
TKAMREQNWTVTHMFLVSEEFFTSLGMFGMPPEFWEKSMLEKPTDGREVVCHASAWDFFN
RKDFRIKQCTTITMEQLFTVHHEMGHVEYYLQYKDQPVTFRSGANPGFHEAIGDVMSLSV
STPVHLQKIGLLSKITEDVESDINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPSRY
NYDWWYLRTKYQGICPPISRNETNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCEAA
NHTGPLHTCDIYQSKEAGKKLSEALETGSSKPWQDVLQQLTGKNKMNASALLEYFSPVTL
WLEEQNRKTNETLGWPDFEWRPPVPEGYPEGLDKVTDEAEAEKFLAEYNSTAEVVWNAYT
EASWAYNVNITEHNKKIMLEKNLEMSNHTLHYGLRARTFDPTDFKDTSIKRILKKLSDIE
RAALPEEELKEYNQLLSEMETIYSVAKVCTSGSACKALDPELTDIMAQSRDYSELLHAWK
DWRDVSGKKIRTHYKRYVELSNKAAKLNGHTDNGAFWRSLYETPTFEDDLENIWQQLQPL
YFNLHAYVRRALYKKYGAELINLKGPIPAHLLGNMWAQSWANVFDLVMPFPNAIKVDATP
AMKRQGWTPKKMFEESDNFFKSLGLIPMPPEFWNKSMLEKPSDGREVVCHASAWDFYNRK
DFRIKQCTVVNMDDLITAHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVMALSVST
PKHLYSIKLLDQIEDSTESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIPEDEYNQ
QWWNLRMKYQGLCPPVPRSEEDFDPGAKFHIPANVPYVRYFVSFIIQFQFHQALCKAAGH
VGPLHKCDIYQSEKAGAILGNALKQGYSKPWPEVMQLITGQPNMSAEALLSYFEPLTKWL
INMNLQNGETLGWPEYTWIPYAGQQANKKVSFLGMSLSSGQATAGQWILLIIGLVLLGAT
IVLGVRYYHMRRGNLKPSLEMELK
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctccggctccgggcgtcctgctgctgctgctgctctgcctccgagcgacgctc
gccctggatgaccccctcaacccccccaatcatcccgccacggaggaaggagccctcctt
ttcgctcaggactacaacagcaccgccgaaacggtcttcttcgagagcgtctctgccagc
tggaattacaacaccaacctgaccgattttaactcccagctgcaggtagcagcctctttg
aaggagcaagaattcatagaagcttggggaaagaaagcaaaagaaagctatggacacatc
tggcagaatttcagtgatcctcaactaaagcatatcatcagttcaatccaaaccttagga
ccgtccaatttacctgtggttaaacgggaaaggtataacactatcctgagtgagatggac
aatatttactctactgccaaggtgtgtccaccaaatcagaactcaaactgttgggctctt
gaaccagagataactgacatcatggccaattctcgtagttacagaaaactgctctatgcc
tgggaaggatggcacaactcagctggcaatcctctaagatccaagtatgaggaatttgtt
tcactaagcaatgaagcttatgaaaaggatggcttcaaggatactggtgcttactggcgt
tcctggtatgactcaccaacttttgaggatgatctggaagaactctatcatgagctggaa
ccactctacctgaatctccatgcttttgtcagaagaaaactgtatgagttgtatggctct
acatatatcaacttgaaaggccccattccagctcacttactaggtaacatgtgggcccag
cagtggaacaacatttatgatatgatggtccctttcccgaataagcccagtctggatgtc
accaaagccatgagggagcaaaactggaccgtaacacacatgttcctggtgtcggaggag
ttcttcacctcgcttggcatgtttggaatgccacctgaattctgggagaaatccatgctg
gagaagccaacagatgggcgggaggtggtgtgccatgcatcggcatgggacttcttcaat
cgcaaagacttcaggataaagcagtgcacaactatcaccatggaacagctattcacagtg
catcatgagatggggcatgttgaatactacctccagtataaggaccaacctgtcaccttc
cgcagtggggccaaccctggctttcatgaagccattggggatgtcatgagcttgtctgtc
tccaccccggtccacctccagaagattgggctgctcagcaaaattactgaggatgtagag
agtgatatcaattatctgcttaaaatggccctggaaaagattgcatttctgccctttggc
tatttgatagaccagtggcgatggaatgtcttcagtgggcgcacccctcccagccgctac
aattatgactggtggtacctgaggacaaaataccaggggatttgccctcctatttcaaga
aatgaaacaaactttgaccctggtgctaaatatcacatcccaggcaacacaccctacatc
aggtactttgtcagtttcatcctgcaatttcagttccacaaggctctttgtgaagctgcc
aaccacactgggcctcttcatacctgtgacatttatcaatcaaaagaagctggaaagaag
ctcagtgaggcattggaaactggatcttctaagccatggcaagatgttctccaacaactc
actggcaaaaataagatgaatgcttcagcattactggaatattttagccctgtcactttg
tggttggaggaacagaacaggaaaaccaatgaaacattgggctggccagattttgagtgg
cgtccccctgttccagagggctacccagaaggccttgataaagtaactgatgaagcagaa
gctgaaaaattcttggcagagtacaacagcacagctgaagtggtatggaatgcgtacaca
gaggcttcgtgggcatacaatgtcaacatcacagaacacaacaaaaagatcatgttagaa
aagaacctggaaatgtcaaaccataccctgcattatggcctccgagcccgaacatttgat
cccaccgatttcaaggacaccagcataaagcgtattctgaagaaactgagtgatatagaa
cgggcagccctacctgaagaggagctgaaggagtataaccagctcctctcagaaatggag
acaatttacagcgtagccaaagtctgtacctcagggtcagcgtgcaaggcattggatcct
gaacttacagacatcatggctcaatcaagggactacagtgagctccttcatgcctggaaa
gactggcgagatgtatcagggaaaaaaataagaactcattacaagagatatgtggagctg
agcaataaagctgccaaactgaatggtcatacagacaatggtgctttctggagatcactg
tatgaaacaccaacttttgaagacgatctggagaacatctggcagcaacttcaaccactg
tacttcaatttgcatgcctatgtgcgtcgggctctctacaagaagtatggggcagaactc
atcaatctcaaaggccctatcccagctcatctgctaggaaacatgtgggcacaatcatgg
gcaaacgtttttgaccttgtcatgccttttcccaatgccatcaaagtggatgctacacca
gccatgaaacgccagggctggactccaaagaaaatgtttgaagagtctgataatttcttc
aaatccttgggcctcattccgatgccacctgaattctggaataaatccatgctggaaaag
ccaagtgatgggagggaagtggtctgccatgcctcagcctgggacttctataatcgcaag
gatttcaggattaagcaatgcactgttgtgaatatggatgatttaataacagctcaccat
gaaatgggtcatgtccaatactttctacagtacaaggaccagcccatctcattccgtgat
ggagccaatccaggattccatgaagccatcggagatgtcatggccttatcagtatctacc
ccaaagcacttgtacagcatcaaattgctggatcagattgaagatagtacggagagtgac
atcaactacttgatgagcattgcactggataagattgctttcctgccctttggctacttg
atggatcagtggagatggaaagtgtttgatggacgcattcccgaagatgaatacaatcaa
cagtggtggaatctcaggatgaaataccaagggctatgcccgcctgtgccaagatcagaa
gaagactttgacccaggggcaaaatttcatatccctgccaatgtcccttatgtcaggtac
tttgtcagtttcataatccagttccagttccatcaagccctttgcaaagctgctggccac
gtaggacccttgcacaagtgtgacatctaccagtctgagaaagctggtgctatcctgggg
aatgccttgaagcagggctatagcaagccatggccagaagtcatgcagcttatcacaggg
caacccaacatgtcggctgaggccttgctgtcctattttgaaccactgacaaaatggctg
atcaacatgaacttgcaaaatggtgaaactcttggctggcctgaatacacctggataccc
tatgcaggccagcaagcaaacaagaaagtcagtttccttgggatgtcactgagcagcggt
caagccacagcaggccagtggatattgcttatcattggtcttgtcctccttggtgcaaca
atagtcctgggagtcagatactaccacatgaggagagggaacctcaaacctagcttggaa
atggaattgaaataa

DBGET integrated database retrieval system