KEGG   Pogona vitticeps (central bearded dragon): 110086223Help
Entry
110086223         CDS       T05000                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like isoform X1
  KO
K05620  
transglutaminase 3 [EC:2.3.2.13]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
Enzymes [BR:pvt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     110086223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 686 aa AA seqDB search
MDAVPKIDWKLKENGRGHHTDSYQGTELAVRRGHPFVISLDFGGAAPASNSLTFTVETGS
TPALQAKTRVSFGISSASSDGSWGAVQAPSASSGSLSVSISSPANAVIGRYRLGLKAGSA
SSILGTFVLLFNPWLSADEVFLPKEAERQEYVLSESGVVFVGSANSISPRGWDYGQFQKG
ILDACLAMLDRSLNHRKDPATDLRRRNDPKYVGRVLSAMVNSNDDNGVLQGNWSGNYSGG
ASPGSWSGSADILQKWKASGFKPVRYGQCWVFAGVLNTALRCLGMPARTISNFNSAHDTD
QTLTIDVYYDDSGNPLNITSDSIWNFHVWNESWFARSDLGSTYNGWQVLDATPQERSTGI
FQCGPASLIAIKEGDVDQDYDCPFVFSEVNADRVTWTYDTRSGEKKKIYAETRTIGQFTS
TKAVGSFARQDVTGNYKYPEGSAKEREVFKKARGKLNLNTLDATSTQLAAAKKPDVAGKF
KLQSPPQVGKDVDLVLLLTNVAAAERNLSTNMTAWTIIYTGKPVHEVWKSSMKVTLGPKE
EKSIPIKISYADYQQHLTTDNMIRATAVCHIEEGHDALVERDVSLDNPNVTVKVLGPAKV
GQEVKVDMVFTNPLEEEVKDCVLQAEGSDLLETKLKIDVPPVKAKQSARVQFGIKPSKSG
TKQLLINFSCNKFQDIKAFEIIDVAN
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgtgccaaagatcgattggaaactgaaggaaaatggccgtggccaccacacg
gattcctaccagggcacggagctggcggtgcgccgaggccaccccttcgtgatctctttg
gacttcggtggagctgctccggcttcgaacagcctcaccttcaccgtagaaacagggtcg
actccagcgctgcaggcaaagaccagagtctcgttcggcatctccagcgcatccagtgac
ggctcctggggggcagttcaagccccctctgcgtcctccggttccttgagcgtctccatc
tccagcccggccaacgcggtcatcgggcgctaccggctgggcctcaaggccggctccgct
tcctccatcctcggcacttttgtcttgctgttcaacccgtggctgtcagcggacgaggtg
ttcctccctaaagaggccgagcgccaggagtatgtcctctccgagtccggcgtggtcttc
gtgggcagcgccaacagcatcagcccccgcggctgggactacgggcagtttcaaaaaggt
attctggatgcctgtctcgccatgctggaccggagcttaaaccaccgcaaagacccagct
actgacttgcgccgccgaaatgaccccaaatatgttggacgggtgctcagtgcgatggtt
aacagcaatgatgacaatggggtgttgcaaggaaattggagcgggaattactcgggggga
gcgagcccaggcagctggtcaggaagtgctgacatcctgcagaaatggaaggcctccgga
tttaaaccggtccggtacggacagtgctgggtctttgcaggcgtgttgaacacagccctc
cgatgcctcgggatgcccgctcgcaccatctccaacttcaactctgcccacgacaccgac
cagaccctgacgatcgatgtctactatgatgattctggaaaccccctgaacatcacgtcg
gacagcatctggaacttccatgtgtggaatgaaagctggtttgctcgatccgacctcggg
tccacatacaacgggtggcaagttttggatgcaactcctcaggagagaagtacaggtata
ttccagtgcggcccagcttccctgatagccatcaaggagggagatgtggatcaggactac
gactgcccgtttgtcttctccgaagtcaacgctgaccgggtgacctggacctacgacacc
agaagtggggagaagaagaagatctacgccgagaccaggaccatcggccagttcacgagc
acaaaggctgtcggtagctttgcccgccaagacgtcaccggcaactataaatacccagaa
ggttctgccaaagaacgggaagtgttcaagaaggcccgcggcaagctgaacctgaacacg
ctggacgccacctccacccagctggccgcagccaagaagcccgacgtggccgggaagttc
aagcttcagagccccccgcaggtgggcaaggatgtcgacctggtcctgctcttgaccaac
gtggccgcagcagaaaggaacctgtccaccaacatgaccgcctggaccatcatctacacc
ggcaagcctgtccatgaggtctggaagagctccatgaaagtgacccttggccccaaagaa
gagaaatccattcctattaaaatctcctacgctgattaccagcagcacctgacgacagac
aacatgatccgagccacggccgtctgccatatcgaagaaggccacgatgctctggtggag
cgagacgtctccctcgacaaccccaatgtcactgtgaaggtgctgggcccggccaaggtg
ggccaggaagtgaaagtggacatggtcttcaccaaccccctggaggaagaggtgaaggac
tgcgtccttcaggcggagggcagcgacttgctggagacgaagctcaagatcgatgtgcca
cctgtgaaggccaagcagagcgctcgtgttcagtttgggatcaagcccagcaagagcggg
accaagcagctgctgatcaatttctcctgcaacaaattccaagacatcaaagcctttgag
atcattgacgtggccaactga

DBGET integrated database retrieval system