KEGG   Pogona vitticeps (central bearded dragon): 110087569Help
Entry
110087569         CDS       T05000                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:pvt00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    110087569 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    110087569 (SOD2)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110087569 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MLCRLVSRGSPSRNVTKLIAPLGCLASRQKHTLPDLPYDYGALQPHISAEIMQLHHSKHH
ATYVNNLNVAEEKYKEALAKGDVTAQVSLQPALKFNGGGHVNHTIFWTNLSPNGGGEPTG
ELMEAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKEQSRLQIAACSNQDPLQGTTG
LIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYAAGKK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgctctgccggttggtgtcccggggcagccccagcagaaatgtcactaaactgatagca
ccgcttggatgtctggcttctagacaaaagcatactctccctgatttaccttatgattat
ggtgccttgcagccacatattagtgcagaaatcatgcagcttcaccacagcaaacatcat
gctacatatgtaaataatctgaatgttgctgaagaaaaatacaaagaggctttggcaaaa
ggtgatgtgactgctcaggtgtctcttcaaccggctctgaagttcaatggaggaggtcat
gttaaccatactattttctggacaaatctttctcctaatggtggtggggaaccaacagga
gagctaatggaagccattaagcgagattttggctcctttgcaaatttcaaggaaaagctg
acagcagtttcagttggtgttcaaggttcagggtggggatggcttggttataataaagaa
caaagccgcttacagattgctgcctgttccaatcaggatccccttcaaggaaccacaggt
ctcatccccttactcggaattgatgtatgggaacatgcatattatcttcagtataaaaac
gttaggcctgactatctcaaagctatctggaatgtgatcaactgggaaaatgtatcttca
agatatgcagctgggaagaaatag

DBGET integrated database retrieval system