KEGG   Phaseolus vulgaris (common bean): PHAVU_001G034500gHelp
Entry
PHAVU_001G034500g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
pvu  Phaseolus vulgaris (common bean)
Brite
Enzymes [BR:pvu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PHAVU_001G034500g
Chromosome [BR:pvu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     PHAVU_001G034500g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 397 aa AA seqDB search
MQWVRKVYFWIIRVISHSIFGACMKLVNRVSEFSKNISDSSPPPLLSLSMSSSSVNDTEA
LRRNRILSSKLYFDVSPSKVPLIYSESYDIAFLGIEKLHPFDSSKWGRICRFLVSFGILD
KKCIVEPLEASKDDLLVVHTELYLNRLKESSKVAMIVEVPPVALIPNCLVQQKLLSPFRK
QVGGTVLAAKLAKERGWAINVGGGFHHCSAEKGGGFCAYADISLCIHFAFVRLNISRVMI
IDLDAHQGNGHEMDFAYDSRVYILDMYNPGIYPLDYEARNYINQKVEVKSGTVTEEYLQK
LDEALEVAGRRFNPELVIYNAGTDILEGDPLGRLEISPEGIALRDEKVFRFARERNIPIV
MLTSGGYMKSSARVIADSIVNLSKKCLIETSGAPKSS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggtaagaaaagtgtatttctggataattcgagttatctcacattccattttc
ggtgcatgcatgaaattggtcaaccgagtgtccgagtttagcaagaacatctccgattct
tcaccaccgccattgttatcgctgtcgatgtcgtcttcttccgtgaacgacaccgaggct
ctccggcgcaatcgcatcctctccagcaagctctacttcgacgtgtctccgtccaaggtt
ccgctaatctactccgagtcctacgacatagcgtttctcggcatagagaaactgcatccg
tttgattcgtcgaagtggggacgcatttgccgattcctcgtttcgtttggtattctcgac
aaaaaatgcatcgttgagcctctggaagcttccaaggatgatcttctagtggttcacact
gaattgtatctgaataggctgaaggagagttcaaaagttgctatgatagttgaggtccct
cccgtggcattaattcccaattgtcttgtgcaacaaaaacttctttccccgttcaggaag
caggttggaggaactgtactggctgcaaaacttgcaaaggagagaggatgggccattaat
gttggaggaggttttcatcactgctctgcagaaaaaggaggtggattctgtgcttatgca
gatatttctctttgcatccactttgcttttgttcggttgaatatatcaagggtgatgatc
attgatcttgatgcacatcaaggaaacggtcatgaaatggactttgcctatgatagccga
gtctatatcttggatatgtacaatcctggaatatatcctttggattacgaggctagaaac
tacataaatcagaaagttgaagtaaagagtgggacggttacagaagagtacctgcaaaaa
ttagatgaagcactagaggttgctgggcgtaggtttaaccctgagttggtaatttataat
gctggaaccgacatcctagaaggagatccattaggaaggttggagatcagtcctgaagga
attgcccttagagatgaaaaagttttccggtttgctcgtgagagaaacattcccatcgtc
atgctcacttcaggtggttacatgaaatctagtgccagagtgattgcagattcaatagtc
aatctttccaagaaatgcttgatagaaaccagtggagctccaaagtcttcgtga

DBGET integrated database retrieval system