KEGG   Phaseolus vulgaris (common bean): PHAVU_002G308400gHelp
Entry
PHAVU_002G308400g CDS       T03093                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
pvu  Phaseolus vulgaris (common bean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHAVU_002G308400g
   00051 Fructose and mannose metabolism
    PHAVU_002G308400g
   00052 Galactose metabolism
    PHAVU_002G308400g
   00500 Starch and sucrose metabolism
    PHAVU_002G308400g
   00520 Amino sugar and nucleotide sugar metabolism
    PHAVU_002G308400g
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PHAVU_002G308400g
Enzymes [BR:pvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PHAVU_002G308400g
Membrane trafficking [BR:pvu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PHAVU_002G308400g
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 498 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMISSRKWSRAIAILKEFEEKSGTPLAKLRQVAD
AMDVEMHAGLASEGGSKLNMLISFVDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKG
VIGQEFAEVSIPPQLMTGTSEALFDFIASALAKFVAAEPEGFHPPPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFNIEDTVGEDVVGELTKSMEKIGLDMRIAALVNDTIGTLAGGRF
YNQDVIAAVILGTGTNAAYVERAHAIPKWHGLIPKSGDMVINMEWGNFRSSYLSLTEYDL
ALDAESLNPGEQIFEKLISGMYLGEIVRRALLKMAEEADFFGDTVPPKLKVPFILRTPDM
SAMHHDTTSDLKVVGNKLKDILEISNTSLKMRKIVVALCDIVATRGARLAAAGILGILKK
LGRDTVKVGEKQKSVIALDGGLFEHYAKFRECLESTLKELLGEEAAETIVIEHANDGSGI
GAALLAASHSQYLGVEES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggtcgcggtgggagctgcagttgtctgcgccgccgccgtttgcgccgcggcg
gcgctggtggtgcgccaccgcatgattagttcccgcaagtggagtcgcgccatagcgata
ttgaaggagttcgaggaaaagagtgggaccccacttgcaaagcttagacaagtggctgat
gccatggatgtcgagatgcacgcaggtctcgcatctgaaggtggtagcaagcttaacatg
ttgatcagtttcgtcgataatctccctactggggatgaggaaggactctattatgcactg
gaccttggtggcacaaacttccgcgtccttcgtgtacatctgggtgggaaagacaaaggt
gttattggccaggagtttgcagaagtttcaattcctccacaattgatgactggtacttca
gaggcattatttgattttatagcatcagctcttgccaagtttgttgctgcagaaccagaa
ggttttcatcctccccctggcagacaaagagaactgggttttacattctcattcccagtg
aggcaaacatcaatttcatctgggactctaattaagtggactaaaggttttaatattgaa
gatacggttggtgaagatgtggtaggagaactaaccaagtccatggaaaaaattgggctg
gatatgcgaattgctgctctagttaatgataccattggaacattagctggaggcagattc
tacaatcaggatgtaattgctgctgtgattcttggtactgggacaaatgcagcatatgta
gaacgtgcacatgctattccaaaatggcacggccttataccaaaatcaggagatatggtt
ataaacatggagtggggcaatttccgatcatcatatctttcccttacagaatatgatcta
gctcttgatgctgagagtttaaaccctggagaacagatttttgagaaattgatttcgggc
atgtatttgggggagattgttaggagagctttgctgaagatggccgaagaagctgacttt
tttggagatactgttccacccaaattgaaagttcctttcatacttaggacacctgacatg
tcagccatgcaccacgacacaacttctgatctgaaagtggttggaaacaaattaaaggat
atattagagatctcgaacacatctctaaaaatgaggaagattgttgtggcactatgtgac
attgttgctactcgcggggcccgccttgctgccgctggtattttgggcatcctcaagaaa
ctaggaagagacacagttaaggttggggagaagcaaaagtcggtgattgcattggatgga
ggattgtttgaacactatgctaaattcagagaatgcctggagagtacactgaaggaattg
ctgggagaggaggctgctgagaccattgtcattgagcatgctaatgatggctcaggcatt
ggtgcagcccttctggcagcttctcactcccagtatttgggagtggaggagtcttaa

DBGET integrated database retrieval system