KEGG   Pyrus x bretschneideri (Chinese white pear): 103959918Help
Entry
103959918         CDS       T03446                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pxb  Pyrus x bretschneideri (Chinese white pear)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pxb00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103959918
Enzymes [BR:pxb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103959918
Transporters [BR:pxb02000]
 Other Transporters
  Pores ion channels [TC:1]
   103959918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 220 aa AA seqDB search
MATEDVVLLDCWASPYCMRVKIALEEKGIKYEERAEDLFGGKSELLLTSNPVYAKVPVLL
HKGKPLCESSIIVGYIEETWASPPLLPSCPYARSQAKFWVDYVDKKLFDAGGNIWRTKGE
AQEVAIKDFIEVLKQLEKVLGDKDFFGGDSFGFVDIITIAITSWFLAFEKFGNFKVEDHT
PKLSAWINRCMQRKTVAKVIPDPEKIYEFVINLKKMMGME
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagaagatgttgttctcttggactgctgggctagcccgtactgcatgagggtg
aagattgccttggaggaaaagggcatcaaatatgaagaaagagctgaggatctctttgga
ggcaagagtgaactgctgctcacatccaacccagtttacgccaaggtgcccgtgttgctt
cacaaaggaaaaccattgtgtgagtcaagcatcatcgtcggctacattgaagagacctgg
gcttccccaccattgctcccatcgtgcccttatgctcgttctcaggccaagttctgggta
gactacgttgacaagaagctgttcgatgcaggaggcaatatatggaggaccaaaggagaa
gcacaagaggtggctataaaagacttcatagaagtcttaaagcagctagagaaagttctt
ggggacaaagatttcttcggtggcgatagctttggtttcgttgacatcataacgatcgct
ataacgagctggttccttgcattcgaaaaatttggaaacttcaaggttgaagaccacaca
ccaaagttatcagcttggattaataggtgcatgcagagaaagacagtagccaaagtcatc
ccagacccagaaaaaatctatgaattcgtcatcaacctcaaaaaaatgatggggatggaa
tag

DBGET integrated database retrieval system