KEGG   Paenibacillus xylanexedens: BS614_06950Help
Entry
BS614_06950       CDS       T04676                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pxl  Paenibacillus xylanexedens
Brite
Enzymes [BR:pxl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BS614_06950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: APO43774
UniProt: A0A1L5LK97
LinkDB All DBs
Position
complement(1538463..1539743)
Genome map
AA seq 426 aa AA seqDB search
MNWYEYGHLLPLRTLEEIRFWKEQEKEHTLVIRALVPDLEPPYVKLLEEWEVTFANSERV
ANQLLKQLLPATHPPAPYMVRCIDQLVLAARQQSREFIKQLYVLLEQSAAVQAVPLAKVL
ILHFIRESEYFLGVLDTLGQPGILRETDSEPSLFLENALHTSGPGSIHRQASEAPTSPEG
NVNAPAGSAHIQSATIQPPSTGTTQATPSSTAPPVKEKPVPIGGHTLPPLPYAYNALEPH
IDELTMRIHHDKHHQSYVDGLNVAEKKLAESRKKNNFELIKHWERELAFNGAGHYLHTIF
WTIMNPAGGGKPSGMLAEQIKRDFGSYEAFKNQFTEAANKVEGSGWAMLVWSPRAHRLEI
LQAEKHQNLSQSDIVPLLPLDVWEHAYYLKHQNERKKYIEDWWNVVYWPAVAERYETARK
LLWPPY
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaactggtatgaatatggtcacctgctgcctctgcggacattggaggaaatccgtttc
tggaaagagcaggagaaagaacatacactcgtcattcgtgccctggttcctgatctggag
cccccatacgtcaagctactggaggaatgggaggttacctttgcaaacagtgagcgagta
gccaatcagcttttaaaacaactattgcccgcaacccatccacctgctccctacatggtt
cgttgtatcgatcaacttgttttggcagctcggcagcaatcgagagagttcatcaaacag
ctgtatgttcttctggagcaaagtgctgctgtgcaagctgttccgcttgccaaagtactc
attctgcattttatccgcgagtcggagtattttctgggcgtattggatacgcttggccaa
cctggcatcttgcgtgaaacggattcggaaccgtcactttttctggaaaatgcgctgcat
acgtcagggccaggaagcatccatcgccaagcttcagaagccccaacttctccagaggga
aatgtaaatgcacctgccggttcagctcatatccaatccgcaaccattcaaccaccttct
accggaacaacacaagccacacccagctctacagcacctcccgtaaaagagaagccggtt
cccatcggaggacacacactgcctcctctcccctatgcgtacaatgcgctggagccacat
attgatgagctgacgatgcgtatccatcatgacaaacaccatcaatcttatgtggatgga
ctaaatgtagcagagaagaagctggcggaatcgcgaaaaaagaataactttgaactcatc
aaacattgggaacgtgaacttgccttcaacggggcaggccactacctgcatacgatcttc
tggacaattatgaaccctgctggcggcggcaaaccttccggtatgctcgcagagcagatc
aagcgagatttcgggagttatgaagcgtttaagaatcaattcacagaagccgcgaacaag
gtggaaggcagtggctgggcgatgcttgtctggagcccgagagcacatcgtttggagatt
ttgcaggcggaaaaacaccagaacctgtcccagtccgatatcgtaccactcctgccactg
gatgtgtgggaacatgcctactatctgaaacatcagaatgaacgcaaaaagtatatcgag
gattggtggaacgttgtctactggcccgctgtggccgagcgttacgaaacggcacgcaag
ttgttgtggccgccttattaa

DBGET integrated database retrieval system