KEGG   Paenibacillus xylanexedens: BS614_25730Help
Entry
BS614_25730       CDS       T04676                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
pxl  Paenibacillus xylanexedens
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pxl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BS614_25730
Enzymes [BR:pxl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BS614_25730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5892003..5893982
Genome map
AA seq 659 aa AA seqDB search
MKIGIDYYPEQWTPELWEKDAVLMRETGVAVVRMAEFAWSRMEPNEGNYQFEWLDAAIEV
FASRGMEIVLCTPTNTPPNWMTTRYPDVLPMDEQRHIIRPGVRGHRCNNSPSLRMLGSKF
VEAISQRYGKHPAVIGWQIDNEMHYQECHCDTCNRAFVAWLQKRYSNLEELNREWGTVVW
SGEYSSWAEVTTPLGPSKPMNPSYLLEYKRFCSDSVGYLLGWQLEILRRNCPGQFVTHNM
WQYPNSLDYYDMHNELDFVSVDYYPNELYRDYGDRFPRNGALTLDLVRGIKRRNFWVMEQ
LSGAQGAWMPIQRTPYPGLIRARSWQTIARGADMVVHFRWRSATVGAEQFWHGLIDHSNV
PGRRFREFAELTREVNRLGEMLADSTIVTQVAILHSHDQHTALSLQPQAEGGMHYIDNLS
SMHNAFLKMGVGTDVINWTEELDGYKLVIVPSLFLLSEEIAQRLERFAAKGGTVVLTNRT
GVKNMRNVCEMLPLPGLLAEAAGVVVSEYDAIGNSEHRIRNAEGKTFAAKQWCDLLELRG
AEPIAWYDNDFYEGVPAVTVNKFGEGEVYYVGTWPEPSYFYQLFEGILKEKELAPKIQLP
EGVELSIRTKGEQNFLFLINLTNEQREITLDVPFRSLLTSERLDQKLTLPAMGVDIITV
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
attaagatcggaattgattattatccagagcaatggaccccggagttatgggagaaagat
gctgtacttatgcgagagacgggggttgctgttgtgcgaatggcggagttcgcctggagc
cgaatggaaccgaatgagggtaattatcagtttgaatggctggatgcggctatagaagta
ttcgcttcgcgcggcatggaaattgtgttgtgcaccccaaccaataccccgccaaactgg
atgacaacacgttatccggatgtgctgcccatggatgaacaacgccacatcattcggcca
ggtgtgcgtggacatcgttgcaacaacagcccttccttgagaatgctgggctccaaattt
gtggaagcgatatcacagcgctatggtaagcatcccgccgtcattggctggcaaatcgat
aacgagatgcactaccaggagtgccattgtgatacatgtaatcgtgcatttgtcgcttgg
ctgcaaaagcgttattccaatctggaggaattgaaccgggagtggggtacggtcgtctgg
agtggtgagtacagcagctgggctgaggtaacaacaccactcggacccagcaaaccaatg
aatccttcctatcttctggagtacaaacgattttgttctgacagcgtaggctatctgctg
ggatggcagcttgagattttacgccgtaactgtccaggccaatttgtgacgcataacatg
tggcagtatccgaatagtctggactattatgatatgcacaacgaattggacttcgtctct
gttgattattatccaaatgagctgtatcgcgattatggcgatcggtttccgaggaacgga
gcgcttacgctggacttggttcgcggcatcaaacgccgcaatttctgggtaatggaacag
ctcagcggagcacagggtgcctggatgccgattcagcgcaccccgtatcctggactgatc
cgagctcgctcctggcagacaatcgctcgcggtgcggatatggtcgtccatttccggtgg
cggagtgctaccgtcggagcggaacagttctggcatgggctaatcgaccacagcaatgtt
cctggacgcaggttcagggagtttgctgagcttactcgcgaggtgaaccggttaggagaa
atgctcgccgactcaaccattgttacccaggttgcgattctgcattcgcatgatcagcat
acggcactttcccttcagccacaggcggaaggaggaatgcactatatagacaacttgtcc
tctatgcataatgcatttctgaaaatgggtgttggtacagacgttatcaattggaccgag
gagctcgatgggtacaagctggtcattgtcccttctctcttcctgttaagtgaagaaata
gcacagcgactggagcgattcgcagctaaaggggggacggttgtcctcacaaatcggacc
ggtgtgaagaacatgaggaatgtatgtgagatgctgcctctgccggggctactggccgaa
gccgcgggtgttgtcgtaagtgaatatgatgccatcggcaacagtgagcatcggatacgg
aacgcggagggcaagacattcgctgcgaagcaatggtgtgatctactggaactgcgaggc
gcagagccgatcgcctggtatgacaacgacttttacgagggtgtaccggcggttactgtc
aataagtttggtgaaggtgaagtgtattatgttggcacttggccggagccatcgtatttc
tatcagttgtttgaaggcatattgaaggaaaaggaattggcgcccaaaatccagctgccg
gaaggtgttgagctgtcgattcgaacgaagggggagcaaaacttcctcttcctgatcaat
ttgacgaatgagcaacgagagattacgctggacgttccttttcgcagcttgttgaccagc
gagaggttggatcagaagttgactcttccagctatgggagtagatattataactgtataa

DBGET integrated database retrieval system