KEGG   Plutella xylostella (diamondback moth): 105380365Help
Entry
105380365         CDS       T03915                                 

Definition
(RefSeq) alpha-amylase 1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pxy  Plutella xylostella (diamondback moth)
Pathway
pxy00500  Starch and sucrose metabolism
pxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pxy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105380365
Enzymes [BR:pxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     105380365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase TORC_M
Motif
Other DBs
NCBI-GeneID: 105380365
NCBI-ProteinID: XP_011548197
LinkDB All DBs
Position
Un
AA seq 486 aa AA seqDB search
AAHNTPSDAPGHSAMVHLFEWKWDDIADECERFLGPKGFGGVQISPPNENLVIWGKNRPW
WERYQPMSYKLVTRSGNEQQFADMVRRCNNAGVRIYPDAIINHMTGNDPENVGTGGSTGD
FHNWQYPGVPYGRNDFNWPHCVIGGNDYACCADRVRNCELAGLKDLNQGTEYVRDQIVNY
MNRLIDLGVAGFRIDAAKHMWPGDLSVIYSRLHNLNTAHGFPSGARPYIYQEVIDLGGEA
VRREEYTSLAAVTEFKFGLELSNAFKGNNQLIWLSTWGPAWGLLPHDDALTFIDNHDNQR
GHGAGGNILTYKQAKQYKAAIAFMLAHPYGEPQLMSSFDFWDTEAGPPMDHHGNIISPSI
NSDNTCGNGWICEHRWRPIYQMVGFRNAAGNTGVNDWWDNGSNQIAFCRGGNAFVAFNGD
SWALNESLQTCLPAGTYCDVISGEKSHHSCTGKTVTVGHDGRAHISISPGDFDMVLAIHV
GSESRL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gctgcccacaacaccccctccgatgcgccgggccactccgccatggtgcacctcttcgag
tggaagtgggacgacatagctgacgagtgcgagagattcctcggacccaagggattcgga
ggtgttcagatctcacccccgaatgagaacctggtgatctggggcaagaaccgtccatgg
tgggagcgctaccagcccatgtcctacaagctggtcacacggtcaggcaacgagcagcag
tttgctgacatggtgcggagatgtaataacgctggcgtcagaatctacccagatgccata
atcaaccacatgacaggtaacgacccagagaacgttggaactggaggcagcactggtgac
ttccacaactggcagtatcctggcgtgccctatggcaggaacgacttcaattggcctcac
tgtgtcattggtggcaacgactacgcttgttgtgctgatagggtacgaaattgtgagttg
gcaggtctcaaagacttaaaccagggcactgaatacgttcgtgaccaaatagttaactac
atgaacagactcatcgacttaggtgtagctggattcagaatagatgctgccaagcacatg
tggccaggagacctcagcgtcatctacagcagacttcataacttgaacactgctcatggt
ttcccgtctggtgctagaccttacatctaccaagaagttatcgaccttggaggagaagct
gtgagaagagaagaatacacatccttagcggctgtcacagaattcaaatttggactggaa
ctgagcaatgcttttaagggaaataatcagttgatatggttgtccacttggggacccgca
tggggtctgctgcctcacgatgatgctttgaccttcatcgacaaccatgacaaccagaga
ggtcatggtgctggtggaaacattttgacctacaagcaagcaaagcagtacaaagcagct
atagctttcatgttggcacatccttacggagagcctcaactgatgagcagttttgacttc
tgggacaccgaagctggccctccgatggatcaccatggcaacattatttctccttctatc
aactcggataacacgtgtggaaatggctggatctgtgagcatcgttggcgcccaatctac
cagatggttggctttaggaatgcagccggcaacacaggggttaacgactggtgggacaat
ggcagcaatcagatcgccttctgtcgcggtggaaatgcgtttgtcgctttcaacggagac
tcgtgggctttgaatgagagcttgcagacttgtctgccagctggcacgtactgtgacgtg
atctccggagagaagtcccaccactcctgcaccggcaagacggtgactgtgggacacgac
ggtcgcgcgcacatcagcatctcacccggtgactttgacatggtcctcgccatccatgtt
ggctctgagtcaagactgtaa

DBGET integrated database retrieval system