KEGG   Paracoccus yeei: A6J80_04590Help
Entry
A6J80_04590       CDS       T04781                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pye  Paracoccus yeei
Pathway
pye00473  D-Alanine metabolism
pye00550  Peptidoglycan biosynthesis
pye01100  Metabolic pathways
pye01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pye00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A6J80_04590
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A6J80_04590
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A6J80_04590
Enzymes [BR:pye01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A6J80_04590
Peptidoglycan biosynthesis and degradation proteins [BR:pye01011]
 Precursor biosynthesis
  Amino acid ligase
   A6J80_04590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ARC38418
UniProt: A0A1V0GX72
LinkDB All DBs
Position
complement(437794..438729)
Genome map
AA seq 311 aa AA seqDB search
MRQNLAGRASSSAPKVAVLMGGPSAEREVSLSSGHECAKALRQAGYQVIEIDAGRDLPAR
LADAAPDVVFNALHGRWGEDGCVQGLMEWMGLRYTHSGVLASALAMDKSRAKQAFRDAGL
PVLDSLLADADEVRARHVMPPPYVVKPNGEGSSVGVYIVRDGANAPPHLSPQMPARVMVE
TYAPGRELTVAVLDGTALGVTEIVTEGWYDYDAKYKPGGSRHVVPAQVPAEIDAACRDYA
ERAHHALGCRGLSRSDFRWDDSRGLDGLIILETNTQPGMTPTSLAPEQAAHVGMDFPALC
TRIVEEALCRD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaatttggcgggcagggcgagcagttcggccccgaaagtcgcagtcctgatg
ggcggcccctcggcggaacgcgaggtgtccttgtccagcgggcatgaatgcgcaaaggcg
ctgcggcaggcggggtatcaggtcatcgaaatcgacgcgggccgcgatctgccggcgcgc
ctggccgacgccgcgcccgacgtggtcttcaacgccctgcacggccgctggggcgaggat
ggctgcgtccagggcctgatggaatggatgggcctgcgctatacccattcgggcgtcctg
gcctcggccctcgcaatggacaagtcccgggcaaagcaggcttttcgcgatgccgggctg
cccgttctggacagcctgctcgccgatgcggacgaggtgcgcgcgcgccacgtcatgccg
ccgccctatgtggtcaagcccaatggcgaaggctcctcggtcggggtctacatcgttcgc
gacggcgccaacgcgcccccgcatctgtcgccgcagatgcccgcgcgggtcatggtcgaa
acctacgcccccggccgcgagctgaccgtcgcggtgctggacggcaccgcgctcggcgtg
accgagatcgtgaccgagggctggtacgactacgatgcgaaatacaagcccggcggctcg
cgccatgtggtcccggcgcaggtcccggccgagatcgacgccgcctgccgcgactatgcc
gaacgcgcgcatcatgccctgggatgccggggcctcagccgcagcgatttccgctgggac
gattcgcgggggctcgacggcctcatcatcctggaaaccaacacccagcccggcatgacg
cccacctcgcttgcgcccgaacaggcggcgcatgtcggcatggactttcccgcgctttgc
acccgtatcgtcgaggaggcgctatgccgggactga

DBGET integrated database retrieval system