KEGG   Paracoccus yeei: A6J80_11985Help
Entry
A6J80_11985       CDS       T04781                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pye  Paracoccus yeei
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pye00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A6J80_11985
   00650 Butanoate metabolism
    A6J80_11985
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A6J80_11985
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A6J80_11985
Enzymes [BR:pye01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A6J80_11985
Amino acid related enzymes [BR:pye01007]
 Aminotransferase (transaminase)
  Class III
   A6J80_11985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1933815..1935083
Genome map
AA seq 422 aa AA seqDB search
MTSLTDRKNAAISRGVGMTTQIYAERAENAEIWDAKGNRYIDFAAGIAVVNTGHRHPRVV
QAVRDQLDRFTHTCHQVVPYESYVALAERLNAAVPGDWPKKTAFYTTGADAVENAVKIAR
HYTGRAGVVAFSGGFHGRTYLGMSLTGKVQPYKAGFGPMMNDIWHLPFPVELHGTSQQDA
LAALDRLFKSDIDPARVAAIVVEPVQGEGGFYEVPPGFMQRLREICDQYSMLLIADEVQT
GFARTGRLFAMEHHGVAADLTTMAKGLGGGLPISAVTGRAEVMDSPAPGGLGGTYAGNPL
AVAAAHAVLDVIAEEDLCARATRLGQRLKQRLAGIAHDVPEIVDIRGPGFMNAVEFNIAG
SDKPNPEMTNRVREEALGRNLILLTCGVHGNVIRFLAPLTIPEAVFDEALDILEDSIRAA
RS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctgaccgaccgcaagaacgccgccatctcgcgcggggtgggcatgacgacg
cagatctatgccgagcgcgccgaaaatgccgagatctgggatgccaagggtaaccgctat
atcgatttcgccgccggcatcgccgtggtcaacaccggccaccgccacccgcgcgtggtg
caggcggtcagggaccaactggaccgctttacccacacctgccaccaggtcgtgccctat
gaaagctatgtcgccctggccgagcggctgaacgcggcggtgccgggcgactggcccaag
aagaccgcgttctacaccaccggggccgatgcggtggaaaacgccgtcaagatcgcgcgg
cattacacgggccgggccggggtggtggccttctcgggcgggtttcacggccgcacctat
ctgggcatgtcgctgaccggcaaggtccagccctacaaggcgggcttcgggccgatgatg
aacgacatctggcacctgccctttccggtcgaactgcacggcaccagccagcaggatgcc
ttggcggcgctggaccggctgttcaagtccgacatcgacccggcccgcgtcgccgccatc
gtcgtcgagccggtgcagggcgagggcggcttctatgaggtcccgcccggcttcatgcag
cgtctgcgcgagatctgcgaccagtattccatgctgctgatcgccgacgaggtgcagacc
ggctttgcccgcaccggccggctgttcgcgatggagcatcacggcgtcgcggccgacctg
accaccatggccaagggcctgggcggcgggctgccgatcagcgccgtgaccggtcgggcc
gaggtgatggacagccccgccccggggggccttggcggcacctatgccggcaatccgctg
gccgtggcggccgcccatgccgtcctcgacgtgatcgccgaggaggacctttgcgcccgc
gcgacccgcctgggccagcggctgaagcagcgcctggccgggatcgcccatgatgtaccg
gaaatcgtggacatccgcggccccggcttcatgaacgcggtcgaattcaacatcgcagga
tccgacaagcccaaccccgaaatgacgaaccgcgtccgcgaggaggcgctcgggcgcaac
ctgatcctgctgacctgcggcgtccacggcaatgtcatccgcttcctcgcgccgctgacc
atccccgaggcggtcttcgacgaggcgctggacattctggaggattcgatccgcgccgcc
cgcagctaa

DBGET integrated database retrieval system